270323

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 698077..698723 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag PQK93_RS03155 Protein ID WP_003403137.1
Coordinates 698077..698490 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag PQK93_RS03160 Protein ID WP_003403139.1
Coordinates 698487..698723 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS03135 (PQK93_03135) 694160..695710 + 1551 WP_003403119.1 MlaD family protein -
PQK93_RS03140 (PQK93_03140) 695762..696154 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
PQK93_RS03145 (PQK93_03145) 696151..696408 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
PQK93_RS03150 (PQK93_03150) 696591..697826 - 1236 WP_003403128.1 ATP-binding protein -
PQK93_RS03155 (PQK93_03155) 698077..698490 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS03160 (PQK93_03160) 698487..698723 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
PQK93_RS03165 (PQK93_03165) 698827..699333 - 507 WP_003900973.1 two component system sensor kinase HK1 -
PQK93_RS03170 (PQK93_03170) 699447..699977 - 531 WP_003917320.1 two component system sensor kinase HK2 -
PQK93_RS03175 (PQK93_03175) 699961..700656 - 696 WP_197044064.1 two-component system response regulator TcrA -
PQK93_RS03180 (PQK93_03180) 700779..701090 + 312 WP_003403164.1 hypothetical protein -
PQK93_RS03185 (PQK93_03185) 701162..702112 + 951 WP_003907436.1 DUF1259 domain-containing protein -
PQK93_RS03190 (PQK93_03190) 702353..702937 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
PQK93_RS03195 (PQK93_03195) 702939..703649 + 711 Protein_633 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T270323 WP_003403137.1 NZ_CP117298:c698490-698077 [Mycobacterium tuberculosis variant bovis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT270323 WP_003403139.1 NZ_CP117298:c698723-698487 [Mycobacterium tuberculosis variant bovis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References