Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
| Location | 698077..698723 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ88 |
| Locus tag | PQK93_RS03155 | Protein ID | WP_003403137.1 |
| Coordinates | 698077..698490 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ89 |
| Locus tag | PQK93_RS03160 | Protein ID | WP_003403139.1 |
| Coordinates | 698487..698723 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS03135 (PQK93_03135) | 694160..695710 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
| PQK93_RS03140 (PQK93_03140) | 695762..696154 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
| PQK93_RS03145 (PQK93_03145) | 696151..696408 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
| PQK93_RS03150 (PQK93_03150) | 696591..697826 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
| PQK93_RS03155 (PQK93_03155) | 698077..698490 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQK93_RS03160 (PQK93_03160) | 698487..698723 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | Antitoxin |
| PQK93_RS03165 (PQK93_03165) | 698827..699333 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| PQK93_RS03170 (PQK93_03170) | 699447..699977 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| PQK93_RS03175 (PQK93_03175) | 699961..700656 | - | 696 | WP_197044064.1 | two-component system response regulator TcrA | - |
| PQK93_RS03180 (PQK93_03180) | 700779..701090 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| PQK93_RS03185 (PQK93_03185) | 701162..702112 | + | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
| PQK93_RS03190 (PQK93_03190) | 702353..702937 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| PQK93_RS03195 (PQK93_03195) | 702939..703649 | + | 711 | Protein_633 | IS607 family element RNA-guided endonuclease TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T270323 WP_003403137.1 NZ_CP117298:c698490-698077 [Mycobacterium tuberculosis variant bovis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|