Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 695762..696408 | Replicon | chromosome |
Accession | NZ_CP117298 | ||
Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | PQK93_RS03140 | Protein ID | WP_003403122.1 |
Coordinates | 695762..696154 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | PQK93_RS03145 | Protein ID | WP_003403125.1 |
Coordinates | 696151..696408 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQK93_RS03125 (PQK93_03125) | 691423..692950 | + | 1528 | Protein_619 | virulence factor Mce family protein | - |
PQK93_RS03130 (PQK93_03130) | 693013..694155 | + | 1143 | Protein_620 | virulence factor Mce family protein | - |
PQK93_RS03135 (PQK93_03135) | 694160..695710 | + | 1551 | WP_003403119.1 | MlaD family protein | - |
PQK93_RS03140 (PQK93_03140) | 695762..696154 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
PQK93_RS03145 (PQK93_03145) | 696151..696408 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
PQK93_RS03150 (PQK93_03150) | 696591..697826 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
PQK93_RS03155 (PQK93_03155) | 698077..698490 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
PQK93_RS03160 (PQK93_03160) | 698487..698723 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
PQK93_RS03165 (PQK93_03165) | 698827..699333 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
PQK93_RS03170 (PQK93_03170) | 699447..699977 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
PQK93_RS03175 (PQK93_03175) | 699961..700656 | - | 696 | WP_197044064.1 | two-component system response regulator TcrA | - |
PQK93_RS03180 (PQK93_03180) | 700779..701090 | + | 312 | WP_003403164.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T270322 WP_003403122.1 NZ_CP117298:c696154-695762 [Mycobacterium tuberculosis variant bovis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |