Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
| Location | 34161..34762 | Replicon | plasmid pLV1 |
| Accession | NZ_CP117297 | ||
| Organism | Limosilactobacillus portuensis strain LV1276_C155 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PRK60_RS09860 | Protein ID | WP_273646452.1 |
| Coordinates | 34161..34505 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PRK60_RS09865 | Protein ID | WP_273646453.1 |
| Coordinates | 34499..34762 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRK60_RS09820 (PRK60_09820) | 29395..29457 | - | 63 | WP_222843308.1 | putative holin-like toxin | - |
| PRK60_RS09825 (PRK60_09825) | 29931..30830 | - | 900 | WP_102169381.1 | IS3 family transposase | - |
| PRK60_RS09830 (PRK60_09830) | 30827..31360 | - | 534 | WP_102169382.1 | helix-turn-helix domain-containing protein | - |
| PRK60_RS09835 (PRK60_09835) | 31500..31952 | - | 453 | WP_054193997.1 | hypothetical protein | - |
| PRK60_RS09840 (PRK60_09840) | 31945..32463 | - | 519 | WP_273646450.1 | LysM domain-containing protein | - |
| PRK60_RS09845 (PRK60_09845) | 32471..32653 | - | 183 | Protein_33 | nucleotidyltransferase | - |
| PRK60_RS09850 (PRK60_09850) | 32908..32961 | - | 54 | WP_237738382.1 | hypothetical protein | - |
| PRK60_RS09855 (PRK60_09855) | 33311..33577 | - | 267 | WP_273646451.1 | hypothetical protein | - |
| PRK60_RS09860 (PRK60_09860) | 34161..34505 | - | 345 | WP_273646452.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PRK60_RS09865 (PRK60_09865) | 34499..34762 | - | 264 | WP_273646453.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PRK60_RS09870 (PRK60_09870) | 34849..35082 | + | 234 | WP_023192324.1 | hypothetical protein | - |
| PRK60_RS09875 (PRK60_09875) | 35187..35771 | + | 585 | WP_273646454.1 | recombinase family protein | - |
| PRK60_RS09880 (PRK60_09880) | 36112..36660 | - | 549 | WP_003712348.1 | isochorismatase family cysteine hydrolase | - |
| PRK60_RS09885 (PRK60_09885) | 36662..38101 | - | 1440 | WP_273646455.1 | nicotinate phosphoribosyltransferase | - |
| PRK60_RS09890 (PRK60_09890) | 38217..38921 | - | 705 | WP_273646456.1 | NUDIX domain-containing protein | - |
| PRK60_RS09895 (PRK60_09895) | 39144..39452 | - | 309 | WP_060463328.1 | TetR/AcrR family transcriptional regulator | - |
| PRK60_RS09900 (PRK60_09900) | 39472..39699 | + | 228 | WP_273646457.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..62042 | 62042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13070.83 Da Isoelectric Point: 5.5562
>T270315 WP_273646452.1 NZ_CP117297:c34505-34161 [Limosilactobacillus portuensis]
MVSQGDIFYVNFNPSRGHEQMNRRPAIALSNDLVYQTSNMTIVAPISSTERNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVADEAIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNRRPAIALSNDLVYQTSNMTIVAPISSTERNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVADEAIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|