Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09907-MazE
Location 34161..34762 Replicon plasmid pLV1
Accession NZ_CP117297
Organism Limosilactobacillus portuensis strain LV1276_C155

Toxin (Protein)


Gene name pemK Uniprot ID -
Locus tag PRK60_RS09860 Protein ID WP_273646452.1
Coordinates 34161..34505 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag PRK60_RS09865 Protein ID WP_273646453.1
Coordinates 34499..34762 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PRK60_RS09820 (PRK60_09820) 29395..29457 - 63 WP_222843308.1 putative holin-like toxin -
PRK60_RS09825 (PRK60_09825) 29931..30830 - 900 WP_102169381.1 IS3 family transposase -
PRK60_RS09830 (PRK60_09830) 30827..31360 - 534 WP_102169382.1 helix-turn-helix domain-containing protein -
PRK60_RS09835 (PRK60_09835) 31500..31952 - 453 WP_054193997.1 hypothetical protein -
PRK60_RS09840 (PRK60_09840) 31945..32463 - 519 WP_273646450.1 LysM domain-containing protein -
PRK60_RS09845 (PRK60_09845) 32471..32653 - 183 Protein_33 nucleotidyltransferase -
PRK60_RS09850 (PRK60_09850) 32908..32961 - 54 WP_237738382.1 hypothetical protein -
PRK60_RS09855 (PRK60_09855) 33311..33577 - 267 WP_273646451.1 hypothetical protein -
PRK60_RS09860 (PRK60_09860) 34161..34505 - 345 WP_273646452.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PRK60_RS09865 (PRK60_09865) 34499..34762 - 264 WP_273646453.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PRK60_RS09870 (PRK60_09870) 34849..35082 + 234 WP_023192324.1 hypothetical protein -
PRK60_RS09875 (PRK60_09875) 35187..35771 + 585 WP_273646454.1 recombinase family protein -
PRK60_RS09880 (PRK60_09880) 36112..36660 - 549 WP_003712348.1 isochorismatase family cysteine hydrolase -
PRK60_RS09885 (PRK60_09885) 36662..38101 - 1440 WP_273646455.1 nicotinate phosphoribosyltransferase -
PRK60_RS09890 (PRK60_09890) 38217..38921 - 705 WP_273646456.1 NUDIX domain-containing protein -
PRK60_RS09895 (PRK60_09895) 39144..39452 - 309 WP_060463328.1 TetR/AcrR family transcriptional regulator -
PRK60_RS09900 (PRK60_09900) 39472..39699 + 228 WP_273646457.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..62042 62042


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-101)

Antitoxin

SpoVT-AbrB domain

(12-55)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13070.83 Da        Isoelectric Point: 5.5562

>T270315 WP_273646452.1 NZ_CP117297:c34505-34161 [Limosilactobacillus portuensis]
MVSQGDIFYVNFNPSRGHEQMNRRPAIALSNDLVYQTSNMTIVAPISSTERNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVADEAIVDHVSREELEEIITLYKLLFSIDDK

Download         Length: 345 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10168.50 Da        Isoelectric Point: 6.4690

>AT270315 WP_273646453.1 NZ_CP117297:c34762-34499 [Limosilactobacillus portuensis]
MELIKEQTRLAKWGNSKAARIPSQIIRQLKLDDNQDMTITIENGSIVLTPIKKNPTNIHELFKNWQDDGKRDHELDWGKS
EGNELQW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References