Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1390533..1391153 | Replicon | chromosome |
| Accession | NZ_CP117294 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PRW94_RS06740 | Protein ID | WP_001280991.1 |
| Coordinates | 1390533..1390751 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PRW94_RS06745 | Protein ID | WP_000344807.1 |
| Coordinates | 1390779..1391153 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRW94_RS06700 (PRW94_06700) | 1385756..1386325 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
| PRW94_RS06705 (PRW94_06705) | 1386358..1386747 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| PRW94_RS06715 (PRW94_06715) | 1386978..1388528 | - | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
| PRW94_RS06720 (PRW94_06720) | 1388753..1389013 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PRW94_RS06725 (PRW94_06725) | 1389019..1389159 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PRW94_RS06730 (PRW94_06730) | 1389215..1389685 | - | 471 | WP_000136183.1 | YlaC family protein | - |
| PRW94_RS06735 (PRW94_06735) | 1389803..1390354 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| PRW94_RS06740 (PRW94_06740) | 1390533..1390751 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PRW94_RS06745 (PRW94_06745) | 1390779..1391153 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PRW94_RS06750 (PRW94_06750) | 1391649..1394798 | - | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
| PRW94_RS06755 (PRW94_06755) | 1394821..1396014 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270304 WP_001280991.1 NZ_CP117294:c1390751-1390533 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270304 WP_000344807.1 NZ_CP117294:c1391153-1390779 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|