Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 822370..822995 | Replicon | chromosome |
Accession | NZ_CP117293 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain S2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PRW95_RS04000 | Protein ID | WP_000911334.1 |
Coordinates | 822597..822995 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PRW95_RS03995 | Protein ID | WP_000557549.1 |
Coordinates | 822370..822597 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRW95_RS03965 (PRW95_03965) | 817541..818260 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
PRW95_RS03970 (PRW95_03970) | 818264..818467 | + | 204 | WP_000184036.1 | hypothetical protein | - |
PRW95_RS03975 (PRW95_03975) | 818550..819005 | + | 456 | WP_223229661.1 | hypothetical protein | - |
PRW95_RS03980 (PRW95_03980) | 819107..820228 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
PRW95_RS03985 (PRW95_03985) | 820861..821667 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
PRW95_RS03990 (PRW95_03990) | 821942..822193 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PRW95_RS03995 (PRW95_03995) | 822370..822597 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PRW95_RS04000 (PRW95_04000) | 822597..822995 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PRW95_RS04005 (PRW95_04005) | 823802..824338 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
PRW95_RS04010 (PRW95_04010) | 824385..825017 | + | 633 | WP_000835268.1 | YfdX family protein | - |
PRW95_RS04015 (PRW95_04015) | 825736..826317 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 815299..831440 | 16141 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T270287 WP_000911334.1 NZ_CP117293:822597-822995 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|