Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4196054..4196570 | Replicon | chromosome |
| Accession | NZ_CP117292 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PRW96_RS20580 | Protein ID | WP_000220578.1 |
| Coordinates | 4196054..4196338 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PRW96_RS20585 | Protein ID | WP_000212724.1 |
| Coordinates | 4196328..4196570 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRW96_RS20565 (PRW96_20565) | 4191266..4192918 | + | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
| PRW96_RS20570 (PRW96_20570) | 4193327..4195465 | + | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PRW96_RS20575 (PRW96_20575) | 4195586..4196050 | + | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PRW96_RS20580 (PRW96_20580) | 4196054..4196338 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PRW96_RS20585 (PRW96_20585) | 4196328..4196570 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PRW96_RS20590 (PRW96_20590) | 4196648..4198561 | - | 1914 | WP_001212152.1 | BglG family transcription antiterminator | - |
| PRW96_RS20595 (PRW96_20595) | 4198578..4199318 | - | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
| PRW96_RS20600 (PRW96_20600) | 4199315..4200433 | - | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PRW96_RS20605 (PRW96_20605) | 4200417..4201550 | - | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T270282 WP_000220578.1 NZ_CP117292:c4196338-4196054 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |