Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1013419..1014044 | Replicon | chromosome |
Accession | NZ_CP117292 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain S4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PRW96_RS04905 | Protein ID | WP_000911334.1 |
Coordinates | 1013646..1014044 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PRW96_RS04900 | Protein ID | WP_000557549.1 |
Coordinates | 1013419..1013646 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRW96_RS04870 (PRW96_04870) | 1008590..1009309 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
PRW96_RS04875 (PRW96_04875) | 1009313..1009516 | + | 204 | WP_000184036.1 | hypothetical protein | - |
PRW96_RS04880 (PRW96_04880) | 1009599..1010054 | + | 456 | WP_223229661.1 | hypothetical protein | - |
PRW96_RS04885 (PRW96_04885) | 1010156..1011277 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
PRW96_RS04890 (PRW96_04890) | 1011910..1012716 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
PRW96_RS04895 (PRW96_04895) | 1012991..1013242 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PRW96_RS04900 (PRW96_04900) | 1013419..1013646 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PRW96_RS04905 (PRW96_04905) | 1013646..1014044 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PRW96_RS04910 (PRW96_04910) | 1014851..1015387 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
PRW96_RS04915 (PRW96_04915) | 1015434..1016066 | + | 633 | WP_000835268.1 | YfdX family protein | - |
PRW96_RS04920 (PRW96_04920) | 1016785..1017366 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1006338..1022489 | 16151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T270274 WP_000911334.1 NZ_CP117292:1013646-1014044 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|