Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 538611..539227 Replicon chromosome
Accession NZ_CP117292
Organism Salmonella enterica subsp. enterica serovar Typhi strain S4

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag PRW96_RS02585 Protein ID WP_000238494.1
Coordinates 538853..539227 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag PRW96_RS02580 Protein ID WP_001523745.1
Coordinates 538611..538853 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PRW96_RS02545 (PRW96_02545) 533737..534336 + 600 WP_000965695.1 glucose-1-phosphatase -
PRW96_RS02550 (PRW96_02550) 534330..535202 + 873 WP_000921423.1 virulence factor BrkB family protein -
PRW96_RS02555 (PRW96_02555) 535199..535636 + 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
PRW96_RS02560 (PRW96_02560) 535681..536622 + 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PRW96_RS02565 (PRW96_02565) 536637..537083 - 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
PRW96_RS02570 (PRW96_02570) 537080..537391 - 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
PRW96_RS02575 (PRW96_02575) 537477..538406 - 930 WP_001162859.1 alpha/beta hydrolase -
PRW96_RS02580 (PRW96_02580) 538611..538853 + 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
PRW96_RS02585 (PRW96_02585) 538853..539227 + 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
PRW96_RS02590 (PRW96_02590) 539265..540194 - 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
PRW96_RS02595 (PRW96_02595) 540191..540826 - 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PRW96_RS02600 (PRW96_02600) 540823..541725 - 903 WP_000331359.1 formate dehydrogenase subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T270272 WP_000238494.1 NZ_CP117292:538853-539227 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT270272 WP_001523745.1 NZ_CP117292:538611-538853 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References