Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1390555..1391175 | Replicon | chromosome |
Accession | NZ_CP117291 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain S5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PRW97_RS06745 | Protein ID | WP_001280991.1 |
Coordinates | 1390555..1390773 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PRW97_RS06750 | Protein ID | WP_000344807.1 |
Coordinates | 1390801..1391175 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRW97_RS06705 (PRW97_06705) | 1385778..1386347 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
PRW97_RS06710 (PRW97_06710) | 1386380..1386769 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PRW97_RS06720 (PRW97_06720) | 1387000..1388550 | - | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
PRW97_RS06725 (PRW97_06725) | 1388775..1389035 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PRW97_RS06730 (PRW97_06730) | 1389041..1389181 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PRW97_RS06735 (PRW97_06735) | 1389237..1389707 | - | 471 | WP_000136183.1 | YlaC family protein | - |
PRW97_RS06740 (PRW97_06740) | 1389825..1390376 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PRW97_RS06745 (PRW97_06745) | 1390555..1390773 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PRW97_RS06750 (PRW97_06750) | 1390801..1391175 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PRW97_RS06755 (PRW97_06755) | 1391671..1394820 | - | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
PRW97_RS06760 (PRW97_06760) | 1394843..1396036 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270259 WP_001280991.1 NZ_CP117291:c1390773-1390555 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270259 WP_000344807.1 NZ_CP117291:c1391175-1390801 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|