Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 315768..316363 | Replicon | plasmid pTi6.2 |
| Accession | NZ_CP117269 | ||
| Organism | Rhizobium rhododendri strain rho-6.2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PR018_RS26440 | Protein ID | WP_142832462.1 |
| Coordinates | 315768..315956 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PR018_RS26445 | Protein ID | WP_142832463.1 |
| Coordinates | 315962..316363 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR018_RS26410 (PR018_26415) | 311656..311943 | - | 288 | WP_142832457.1 | integration host factor subunit beta | - |
| PR018_RS26415 (PR018_26420) | 312201..312440 | - | 240 | Protein_311 | hypothetical protein | - |
| PR018_RS26420 (PR018_26425) | 313146..313730 | - | 585 | WP_142832458.1 | hypothetical protein | - |
| PR018_RS26425 (PR018_26430) | 313758..314360 | - | 603 | WP_142832459.1 | hypothetical protein | - |
| PR018_RS26430 (PR018_26435) | 314510..314920 | - | 411 | WP_142832460.1 | SyrB-like regulator | - |
| PR018_RS26435 (PR018_26440) | 315186..315452 | - | 267 | WP_142832461.1 | WGR domain-containing protein | - |
| PR018_RS26440 (PR018_26445) | 315768..315956 | + | 189 | WP_142832462.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PR018_RS26445 (PR018_26450) | 315962..316363 | + | 402 | WP_142832463.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PR018_RS26450 (PR018_26455) | 316462..316857 | - | 396 | WP_244615590.1 | hypothetical protein | - |
| PR018_RS26455 (PR018_26460) | 317523..318035 | + | 513 | WP_142832465.1 | oxidoreductase | - |
| PR018_RS26460 (PR018_26465) | 318032..319732 | + | 1701 | WP_161991033.1 | response regulator | - |
| PR018_RS26465 (PR018_26470) | 319719..320585 | - | 867 | WP_142832467.1 | helix-turn-helix domain-containing protein | - |
| PR018_RS26470 (PR018_26475) | 320883..321170 | + | 288 | WP_142832468.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..381845 | 381845 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 6947.19 Da Isoelectric Point: 11.2826
>T270224 WP_142832462.1 NZ_CP117269:315768-315956 [Rhizobium rhododendri]
MKSVDIISALTNDGWFEVAKKGSHVQLKHPTKRGRVTVPHPKRDIPMGTLKSIEKQSGLKLR
MKSVDIISALTNDGWFEVAKKGSHVQLKHPTKRGRVTVPHPKRDIPMGTLKSIEKQSGLKLR
Download Length: 189 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14238.98 Da Isoelectric Point: 4.4491
>AT270224 WP_142832463.1 NZ_CP117269:315962-316363 [Rhizobium rhododendri]
MRNYIGLIHKEAESDYGVSFPDFPGVVTAGTDLDDARRMAEEALAFHVDGLVEDGEAIPEASSLTDIMANPHNSSGTAIL
VSLKTETKKAVRVNITIPEDVLQEVDAYAEAHGLTRSGFLVQAAKREIGKIAA
MRNYIGLIHKEAESDYGVSFPDFPGVVTAGTDLDDARRMAEEALAFHVDGLVEDGEAIPEASSLTDIMANPHNSSGTAIL
VSLKTETKKAVRVNITIPEDVLQEVDAYAEAHGLTRSGFLVQAAKREIGKIAA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|