Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 1157286..1157971 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117268 | ||
Organism | Rhizobium rhododendri strain rho-6.2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PR018_RS23060 | Protein ID | WP_142832619.1 |
Coordinates | 1157549..1157971 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PR018_RS23055 | Protein ID | WP_142832620.1 |
Coordinates | 1157286..1157552 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR018_RS23035 (PR018_23040) | 1153467..1154051 | - | 585 | WP_219271068.1 | plasmid pRiA4b ORF-3 family protein | - |
PR018_RS23040 (PR018_23045) | 1154051..1155709 | - | 1659 | WP_142832615.1 | IS66 family transposase | - |
PR018_RS23045 (PR018_23050) | 1155787..1156134 | - | 348 | WP_046119556.1 | IS66 family insertion sequence element accessory protein TnpB | - |
PR018_RS23050 (PR018_23055) | 1156131..1156478 | - | 348 | WP_111217014.1 | transposase | - |
PR018_RS23055 (PR018_23060) | 1157286..1157552 | + | 267 | WP_142832620.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PR018_RS23060 (PR018_23065) | 1157549..1157971 | + | 423 | WP_142832619.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PR018_RS23065 (PR018_23070) | 1158074..1159198 | + | 1125 | WP_143123525.1 | IS5 family transposase | - |
PR018_RS23070 (PR018_23075) | 1159352..1159813 | + | 462 | WP_142832600.1 | hypothetical protein | - |
PR018_RS23075 (PR018_23080) | 1160377..1160798 | - | 422 | Protein_1039 | MucR family transcriptional regulator | - |
PR018_RS23080 (PR018_23085) | 1161340..1161663 | + | 324 | WP_142832599.1 | hypothetical protein | - |
PR018_RS23085 (PR018_23090) | 1161809..1161934 | - | 126 | WP_257625516.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1530638 | 1530638 | |
- | inside | IScluster/Tn | - | - | 1155787..1159198 | 3411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15618.02 Da Isoelectric Point: 5.2203
>T270222 WP_142832619.1 NZ_CP117268:1157549-1157971 [Rhizobium rhododendri]
MRLLLDTNVLSEVTKPRPAECVLNWLHGLDEDRTFISIVSIAEIRRGVALMDIGRKRDALDTWLTHDLPQRFDNRIIPVE
AHLALAWGDLMALAKRSGRGLASMDGLIAATAVARDLTLATRNTKDFEGFGIDLVDPWEV
MRLLLDTNVLSEVTKPRPAECVLNWLHGLDEDRTFISIVSIAEIRRGVALMDIGRKRDALDTWLTHDLPQRFDNRIIPVE
AHLALAWGDLMALAKRSGRGLASMDGLIAATAVARDLTLATRNTKDFEGFGIDLVDPWEV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|