Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 816865..817445 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117268 | ||
| Organism | Rhizobium rhododendri strain rho-6.2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PR018_RS21515 | Protein ID | WP_142831763.1 |
| Coordinates | 816865..817248 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PR018_RS21520 | Protein ID | WP_142831764.1 |
| Coordinates | 817245..817445 (-) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR018_RS21500 (PR018_21500) | 812218..814221 | + | 2004 | WP_142831760.1 | aldo/keto reductase | - |
| PR018_RS21505 (PR018_21505) | 814714..815538 | - | 825 | WP_142831761.1 | hypothetical protein | - |
| PR018_RS21510 (PR018_21510) | 815522..816595 | - | 1074 | WP_142831762.1 | AAA family ATPase | - |
| PR018_RS21515 (PR018_21515) | 816865..817248 | - | 384 | WP_142831763.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PR018_RS21520 (PR018_21520) | 817245..817445 | - | 201 | WP_142831764.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PR018_RS21525 (PR018_21525) | 817576..818580 | - | 1005 | WP_142831765.1 | C-terminal binding protein | - |
| PR018_RS21530 (PR018_21530) | 818585..819556 | - | 972 | WP_142831766.1 | 2-dehydropantoate 2-reductase N-terminal domain-containing protein | - |
| PR018_RS21535 (PR018_21535) | 819569..820750 | - | 1182 | WP_142831767.1 | acyl-CoA dehydrogenase family protein | - |
| PR018_RS21540 (PR018_21540) | 820870..821973 | - | 1104 | WP_142831768.1 | LLM class flavin-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1530638 | 1530638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13951.20 Da Isoelectric Point: 8.1224
>T270221 WP_142831763.1 NZ_CP117268:c817248-816865 [Rhizobium rhododendri]
VILVDTSIWIDHFRHGDVELRKVIADDLLLCHPVVVGELALGSLRDRGAVMAFFSAQREALVASHYEVITMIGRHSIFSM
GIGYTDAHLLASILLDRRSLLWTRDKRLAAAARKAGASLYAPTSAPN
VILVDTSIWIDHFRHGDVELRKVIADDLLLCHPVVVGELALGSLRDRGAVMAFFSAQREALVASHYEVITMIGRHSIFSM
GIGYTDAHLLASILLDRRSLLWTRDKRLAAAARKAGASLYAPTSAPN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|