Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 467547..468211 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP117268 | ||
| Organism | Rhizobium rhododendri strain rho-6.2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PR018_RS19925 | Protein ID | WP_142831606.1 |
| Coordinates | 467783..468211 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PR018_RS19920 | Protein ID | WP_142831607.1 |
| Coordinates | 467547..467786 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR018_RS19890 (PR018_19890) | 462918..463400 | + | 483 | WP_142831612.1 | chemotaxis protein CheW | - |
| PR018_RS19895 (PR018_19895) | 463677..464558 | + | 882 | WP_142831611.1 | HD-GYP domain-containing protein | - |
| PR018_RS19900 (PR018_19900) | 464697..464906 | + | 210 | WP_142831610.1 | hypothetical protein | - |
| PR018_RS19905 (PR018_19905) | 465595..465939 | - | 345 | WP_142831609.1 | hypothetical protein | - |
| PR018_RS19910 (PR018_19910) | 466289..466537 | + | 249 | WP_142831608.1 | hypothetical protein | - |
| PR018_RS19915 (PR018_19915) | 466577..467291 | + | 715 | Protein_407 | IS6 family transposase | - |
| PR018_RS19920 (PR018_19920) | 467547..467786 | + | 240 | WP_142831607.1 | Arc family DNA-binding protein | Antitoxin |
| PR018_RS19925 (PR018_19925) | 467783..468211 | + | 429 | WP_142831606.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PR018_RS19930 (PR018_19930) | 468283..468573 | + | 291 | WP_142831605.1 | hypothetical protein | - |
| PR018_RS19935 (PR018_19935) | 468842..469537 | - | 696 | WP_142831604.1 | alpha/beta hydrolase | - |
| PR018_RS19940 (PR018_19940) | 469877..470551 | - | 675 | WP_244615504.1 | permease | - |
| PR018_RS19945 (PR018_19945) | 470931..471359 | - | 429 | WP_142831602.1 | hypothetical protein | - |
| PR018_RS19950 (PR018_19950) | 471582..472409 | - | 828 | WP_142831601.1 | aldo/keto reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1530638 | 1530638 | |
| - | flank | IS/Tn | - | - | 466577..467173 | 596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15196.45 Da Isoelectric Point: 5.8927
>T270220 WP_142831606.1 NZ_CP117268:467783-468211 [Rhizobium rhododendri]
MILLDTNVISEPLKSQPDPRVAAWIDTQAVETLYVAAISLAELRYGIAVHPDGKKKQAAQEKLDRLMLPLFRGRIMPFDE
AAAQAYAELRAAAAKKGKAIGDSDGYIAATAKANGLMIATRDTSPFEAAGLTVINPWEASNG
MILLDTNVISEPLKSQPDPRVAAWIDTQAVETLYVAAISLAELRYGIAVHPDGKKKQAAQEKLDRLMLPLFRGRIMPFDE
AAAQAYAELRAAAAKKGKAIGDSDGYIAATAKANGLMIATRDTSPFEAAGLTVINPWEASNG
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|