Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1441439..1442043 | Replicon | chromosome |
| Accession | NZ_CP117267 | ||
| Organism | Rhizobium rhododendri strain rho-6.2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PR018_RS07165 | Protein ID | WP_142822785.1 |
| Coordinates | 1441439..1441744 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PR018_RS07170 | Protein ID | WP_142822787.1 |
| Coordinates | 1441741..1442043 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR018_RS07145 (PR018_07145) | 1436874..1437236 | + | 363 | WP_142822779.1 | glycine cleavage system protein GcvH | - |
| PR018_RS07150 (PR018_07150) | 1437236..1440100 | + | 2865 | WP_142829148.1 | aminomethyl-transferring glycine dehydrogenase | - |
| PR018_RS07155 (PR018_07155) | 1440137..1440760 | - | 624 | WP_142822782.1 | LysE family transporter | - |
| PR018_RS07160 (PR018_07160) | 1440856..1441248 | - | 393 | WP_142822784.1 | Fe-S cluster assembly scaffold SufA | - |
| PR018_RS07165 (PR018_07165) | 1441439..1441744 | + | 306 | WP_142822785.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PR018_RS07170 (PR018_07170) | 1441741..1442043 | + | 303 | WP_142822787.1 | putative addiction module antidote protein | Antitoxin |
| PR018_RS07175 (PR018_07175) | 1442044..1442424 | - | 381 | WP_142822788.1 | SUF system Fe-S cluster assembly protein | - |
| PR018_RS07180 (PR018_07180) | 1442539..1443780 | - | 1242 | WP_142822791.1 | cysteine desulfurase | - |
| PR018_RS07185 (PR018_07185) | 1443793..1445067 | - | 1275 | WP_142822793.1 | Fe-S cluster assembly protein SufD | - |
| PR018_RS07190 (PR018_07190) | 1445090..1445845 | - | 756 | WP_142822795.1 | Fe-S cluster assembly ATPase SufC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11896.78 Da Isoelectric Point: 10.7321
>T270218 WP_142822785.1 NZ_CP117267:1441439-1441744 [Rhizobium rhododendri]
VFVIQRTEIFQQWIMRLKDRSAAARIASRILRAEDGNLRDVKPVGDGVEEMRIDYGPGYRIYFLRRRSVFVVLLVGGDKS
TQRRDIIEAKRLCAEWKERNQ
VFVIQRTEIFQQWIMRLKDRSAAARIASRILRAEDGNLRDVKPVGDGVEEMRIDYGPGYRIYFLRRRSVFVVLLVGGDKS
TQRRDIIEAKRLCAEWKERNQ
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|