Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 928930..929517 | Replicon | chromosome |
Accession | NZ_CP117267 | ||
Organism | Rhizobium rhododendri strain rho-6.2 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PR018_RS04635 | Protein ID | WP_142829519.1 |
Coordinates | 929227..929517 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PR018_RS04630 | Protein ID | WP_142829521.1 |
Coordinates | 928930..929226 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR018_RS04610 (PR018_04610) | 924894..925847 | + | 954 | WP_224128276.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PR018_RS04615 (PR018_04615) | 925893..926684 | - | 792 | WP_142829526.1 | sulfite exporter TauE/SafE family protein | - |
PR018_RS04620 (PR018_04620) | 926707..927639 | - | 933 | WP_142829524.1 | N-acetyl-gamma-glutamyl-phosphate reductase | - |
PR018_RS04625 (PR018_04625) | 927722..928675 | - | 954 | WP_142829522.1 | agmatinase | - |
PR018_RS04630 (PR018_04630) | 928930..929226 | - | 297 | WP_142829521.1 | putative addiction module antidote protein | Antitoxin |
PR018_RS04635 (PR018_04635) | 929227..929517 | - | 291 | WP_142829519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PR018_RS04640 (PR018_04640) | 929642..930112 | - | 471 | WP_111220548.1 | 30S ribosomal protein S9 | - |
PR018_RS04645 (PR018_04645) | 930115..930579 | - | 465 | WP_111220549.1 | 50S ribosomal protein L13 | - |
PR018_RS04650 (PR018_04650) | 931173..931499 | - | 327 | WP_142829518.1 | hypothetical protein | - |
PR018_RS04655 (PR018_04655) | 931609..932040 | + | 432 | WP_142829516.1 | CoA-binding protein | - |
PR018_RS04660 (PR018_04660) | 932159..933442 | + | 1284 | WP_142829514.1 | O-acetylhomoserine aminocarboxypropyltransferase | - |
PR018_RS04665 (PR018_04665) | 933569..933913 | + | 345 | WP_142829512.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10727.40 Da Isoelectric Point: 10.2980
>T270217 WP_142829519.1 NZ_CP117267:c929517-929227 [Rhizobium rhododendri]
VIEVRQTSIFANWLDALRDAQARQRIVVRIRRLELGNPGDIKPVGEGVSEMRIPHGPGYRLYFTRSGETIVILLCGGDKS
SQARDIAIARQLAKEI
VIEVRQTSIFANWLDALRDAQARQRIVVRIRRLELGNPGDIKPVGEGVSEMRIPHGPGYRLYFTRSGETIVILLCGGDKS
SQARDIAIARQLAKEI
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|