Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/HTH_26(antitoxin) |
Location | 566746..567360 | Replicon | chromosome |
Accession | NZ_CP117267 | ||
Organism | Rhizobium rhododendri strain rho-6.2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PR018_RS02775 | Protein ID | WP_142824284.1 |
Coordinates | 566746..566991 (+) | Length | 82 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PR018_RS02780 | Protein ID | WP_142824285.1 |
Coordinates | 566998..567360 (+) | Length | 121 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR018_RS02755 (PR018_02755) | 562787..563062 | + | 276 | WP_142824280.1 | YlcI/YnfO family protein | - |
PR018_RS02760 (PR018_02760) | 563059..563358 | + | 300 | WP_142824281.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PR018_RS02765 (PR018_02765) | 563914..564972 | + | 1059 | WP_142824282.1 | LacI family DNA-binding transcriptional regulator | - |
PR018_RS02770 (PR018_02770) | 565000..566652 | - | 1653 | WP_142824283.1 | choline dehydrogenase | - |
PR018_RS02775 (PR018_02775) | 566746..566991 | + | 246 | WP_142824284.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
PR018_RS02780 (PR018_02780) | 566998..567360 | + | 363 | WP_142824285.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PR018_RS02785 (PR018_02785) | 567372..568835 | - | 1464 | WP_142824286.1 | betaine-aldehyde dehydrogenase | - |
PR018_RS02790 (PR018_02790) | 568837..570366 | - | 1530 | WP_142824287.1 | choline-sulfatase | - |
PR018_RS02795 (PR018_02795) | 570372..570962 | - | 591 | WP_142824288.1 | transcriptional regulator BetI | - |
PR018_RS02800 (PR018_02800) | 571132..571680 | + | 549 | WP_142829209.1 | HdeD family acid-resistance protein | - |
PR018_RS02805 (PR018_02805) | 571873..572127 | + | 255 | WP_142824290.1 | type II toxin-antitoxin system ParD family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 9194.07 Da Isoelectric Point: 10.9851
>T270216 WP_142824284.1 NZ_CP117267:566746-566991 [Rhizobium rhododendri]
MKDVVVSRLADKALMRMQPKRRLAIIEKVKAYARGEIVDIKKMKGGNLYRIRVGLDRVIIDDKGRIIVVIDAGPRGSIYK
D
MKDVVVSRLADKALMRMQPKRRLAIIEKVKAYARGEIVDIKKMKGGNLYRIRVGLDRVIIDDKGRIIVVIDAGPRGSIYK
D
Download Length: 246 bp
Antitoxin
Download Length: 121 a.a. Molecular weight: 13084.87 Da Isoelectric Point: 4.2616
>AT270216 WP_142824285.1 NZ_CP117267:566998-567360 [Rhizobium rhododendri]
MGDIKRFEIDGKPYVLLSEEDYEDLVDGLRANAVLAGISAGEETWPLEIVEARANGGNAVRIFRNYRRMTVTELAMAAGI
SQPYLSEIEAGKKTGSVDVLKRIATALKVDLDDLVVDVAD
MGDIKRFEIDGKPYVLLSEEDYEDLVDGLRANAVLAGISAGEETWPLEIVEARANGGNAVRIFRNYRRMTVTELAMAAGI
SQPYLSEIEAGKKTGSVDVLKRIATALKVDLDDLVVDVAD
Download Length: 363 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|