Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-ChpS |
| Location | 161794..162380 | Replicon | chromosome |
| Accession | NZ_CP117267 | ||
| Organism | Rhizobium rhododendri strain rho-6.2 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PR018_RS00820 | Protein ID | WP_142829131.1 |
| Coordinates | 162051..162380 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PR018_RS00815 | Protein ID | WP_142823966.1 |
| Coordinates | 161794..162051 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR018_RS00810 (PR018_00810) | 159911..161707 | + | 1797 | WP_142829129.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
| PR018_RS00815 (PR018_00815) | 161794..162051 | + | 258 | WP_142823966.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PR018_RS00820 (PR018_00820) | 162051..162380 | + | 330 | WP_142829131.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PR018_RS00825 (PR018_00825) | 162427..163635 | + | 1209 | WP_142829133.1 | acetyl-CoA C-acetyltransferase | - |
| PR018_RS00830 (PR018_00830) | 163726..165939 | + | 2214 | WP_142823969.1 | 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein | - |
| PR018_RS00835 (PR018_00835) | 166351..166692 | - | 342 | WP_142823970.1 | oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11975.84 Da Isoelectric Point: 9.8009
>T270214 WP_142829131.1 NZ_CP117267:162051-162380 [Rhizobium rhododendri]
VDRGDIWHVDLEPIRGREQAGARYVLVVTKKSFNAIGTPIVVPITTGSEFARFKGFAVSLSGAGTRSSGVILCNQLRSLD
LRARGGKYVESVPDFIMFEVLARITIFFD
VDRGDIWHVDLEPIRGREQAGARYVLVVTKKSFNAIGTPIVVPITTGSEFARFKGFAVSLSGAGTRSSGVILCNQLRSLD
LRARGGKYVESVPDFIMFEVLARITIFFD
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|