Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 155501..156171 | Replicon | plasmid pRt932 |
Accession | NZ_CP117262 | ||
Organism | Rhizobium tumorigenes strain 932 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PR016_RS19370 | Protein ID | WP_278332953.1 |
Coordinates | 155501..155920 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PR016_RS19375 | Protein ID | WP_111215819.1 |
Coordinates | 155917..156171 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR016_RS19350 (PR016_19350) | 151989..153527 | - | 1539 | WP_278332949.1 | hypothetical protein | - |
PR016_RS19355 (PR016_19355) | 153723..153914 | + | 192 | WP_278332950.1 | hypothetical protein | - |
PR016_RS19360 (PR016_19360) | 154207..154785 | + | 579 | WP_278332951.1 | hypothetical protein | - |
PR016_RS19365 (PR016_19365) | 154786..155352 | + | 567 | WP_278332952.1 | hypothetical protein | - |
PR016_RS19370 (PR016_19370) | 155501..155920 | - | 420 | WP_278332953.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PR016_RS19375 (PR016_19375) | 155917..156171 | - | 255 | WP_111215819.1 | plasmid stabilization protein | Antitoxin |
PR016_RS19380 (PR016_19380) | 156631..157776 | - | 1146 | WP_278332954.1 | class C beta-lactamase | - |
PR016_RS19385 (PR016_19385) | 158163..158816 | - | 654 | WP_278332955.1 | flavin reductase family protein | - |
PR016_RS19390 (PR016_19390) | 158817..160238 | - | 1422 | WP_278332956.1 | Xaa-Pro peptidase family protein | - |
PR016_RS19395 (PR016_19395) | 160277..161098 | - | 822 | WP_278332957.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..756443 | 756443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14866.09 Da Isoelectric Point: 5.1007
>T270212 WP_278332953.1 NZ_CP117262:c155920-155501 [Rhizobium tumorigenes]
MILLDTNVVSEPWKPAPDTAVLTWLDAQAIETLFISAISIAELRFGIASMPSGKRQTILHDRLEGEVLPIFDGRVLPFNV
GTAQFYAKLMASAQTSGKAIGKADGYIAATAAENHLAVATRDTSPFEAAGVRVINPWVA
MILLDTNVVSEPWKPAPDTAVLTWLDAQAIETLFISAISIAELRFGIASMPSGKRQTILHDRLEGEVLPIFDGRVLPFNV
GTAQFYAKLMASAQTSGKAIGKADGYIAATAAENHLAVATRDTSPFEAAGVRVINPWVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|