Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 2705481..2706069 | Replicon | chromosome |
Accession | NZ_CP117261 | ||
Organism | Rhizobium tumorigenes strain 932 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PR016_RS13315 | Protein ID | WP_278330333.1 |
Coordinates | 2705481..2705786 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PR016_RS13320 | Protein ID | WP_278330334.1 |
Coordinates | 2705779..2706069 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR016_RS13295 (PR016_13295) | 2700731..2701522 | + | 792 | WP_278330330.1 | aldolase | - |
PR016_RS13300 (PR016_13300) | 2701669..2702616 | - | 948 | WP_278330331.1 | substrate-binding domain-containing protein | - |
PR016_RS13305 (PR016_13305) | 2702690..2703697 | - | 1008 | WP_278332527.1 | ABC transporter permease | - |
PR016_RS13310 (PR016_13310) | 2703709..2705229 | - | 1521 | WP_278330332.1 | sugar ABC transporter ATP-binding protein | - |
PR016_RS13315 (PR016_13315) | 2705481..2705786 | + | 306 | WP_278330333.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PR016_RS13320 (PR016_13320) | 2705779..2706069 | + | 291 | WP_278330334.1 | putative addiction module antidote protein | Antitoxin |
PR016_RS13325 (PR016_13325) | 2706114..2707424 | - | 1311 | WP_111218852.1 | xylose isomerase | - |
PR016_RS13330 (PR016_13330) | 2707538..2708992 | - | 1455 | WP_278330335.1 | xylulokinase | - |
PR016_RS13335 (PR016_13335) | 2709017..2710042 | - | 1026 | WP_278330336.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11382.85 Da Isoelectric Point: 9.9056
>T270211 WP_278330333.1 NZ_CP117261:2705481-2705786 [Rhizobium tumorigenes]
MLELRQTAAFAKWRQRLTDDRARAIIASRLDRLAYGHSGDAQSVGDGVQELRIQYGPGYRIYFKTRGNTLIILLCGSDKS
TQARDISAAKRLLTEWSDDHG
MLELRQTAAFAKWRQRLTDDRARAIIASRLDRLAYGHSGDAQSVGDGVQELRIQYGPGYRIYFKTRGNTLIILLCGSDKS
TQARDISAAKRLLTEWSDDHG
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|