Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1522386..1522990 | Replicon | chromosome |
Accession | NZ_CP117261 | ||
Organism | Rhizobium tumorigenes strain 932 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PR016_RS07675 | Protein ID | WP_278332197.1 |
Coordinates | 1522386..1522691 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PR016_RS07680 | Protein ID | WP_278332198.1 |
Coordinates | 1522688..1522990 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR016_RS07655 (PR016_07655) | 1517822..1518184 | + | 363 | WP_111221915.1 | glycine cleavage system protein GcvH | - |
PR016_RS07660 (PR016_07660) | 1518184..1521048 | + | 2865 | WP_278332196.1 | aminomethyl-transferring glycine dehydrogenase | - |
PR016_RS07665 (PR016_07665) | 1521084..1521707 | - | 624 | WP_111221913.1 | LysE family transporter | - |
PR016_RS07670 (PR016_07670) | 1521803..1522195 | - | 393 | WP_111221912.1 | Fe-S cluster assembly scaffold SufA | - |
PR016_RS07675 (PR016_07675) | 1522386..1522691 | + | 306 | WP_278332197.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PR016_RS07680 (PR016_07680) | 1522688..1522990 | + | 303 | WP_278332198.1 | putative addiction module antidote protein | Antitoxin |
PR016_RS07685 (PR016_07685) | 1522991..1523371 | - | 381 | WP_209183816.1 | SUF system Fe-S cluster assembly protein | - |
PR016_RS07690 (PR016_07690) | 1523486..1524727 | - | 1242 | WP_278332199.1 | cysteine desulfurase | - |
PR016_RS07695 (PR016_07695) | 1524740..1526014 | - | 1275 | WP_278332200.1 | Fe-S cluster assembly protein SufD | - |
PR016_RS07700 (PR016_07700) | 1526037..1526792 | - | 756 | WP_278332201.1 | Fe-S cluster assembly ATPase SufC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11860.75 Da Isoelectric Point: 10.8426
>T270209 WP_278332197.1 NZ_CP117261:1522386-1522691 [Rhizobium tumorigenes]
VFVIQRTEIFQQWIMRLKDRRAAARIASRILRAEDGNLGDVKPVGDGVEEMRIDYGPGYRIYFLRRRSVLVVLLVGGDKS
TQRRDIIEAKRLCAEWRERNQ
VFVIQRTEIFQQWIMRLKDRRAAARIASRILRAEDGNLGDVKPVGDGVEEMRIDYGPGYRIYFLRRRSVLVVLLVGGDKS
TQRRDIIEAKRLCAEWRERNQ
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|