Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 398454..399088 | Replicon | chromosome |
| Accession | NZ_CP117261 | ||
| Organism | Rhizobium tumorigenes strain 932 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PR016_RS01950 | Protein ID | WP_111217666.1 |
| Coordinates | 398681..399088 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PR016_RS01945 | Protein ID | WP_278331353.1 |
| Coordinates | 398454..398684 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR016_RS01925 (PR016_01925) | 394386..394997 | + | 612 | WP_278331352.1 | hypothetical protein | - |
| PR016_RS01930 (PR016_01930) | 395301..397106 | + | 1806 | WP_161959296.1 | DUF3857 domain-containing protein | - |
| PR016_RS01935 (PR016_01935) | 397317..398180 | + | 864 | WP_111217660.1 | S49 family peptidase | - |
| PR016_RS01940 (PR016_01940) | 398199..398390 | + | 192 | WP_111217662.1 | hypothetical protein | - |
| PR016_RS01945 (PR016_01945) | 398454..398684 | + | 231 | WP_278331353.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PR016_RS01950 (PR016_01950) | 398681..399088 | + | 408 | WP_111217666.1 | PIN domain-containing protein | Toxin |
| PR016_RS01955 (PR016_01955) | 399177..400136 | + | 960 | WP_278331354.1 | glycine--tRNA ligase subunit alpha | - |
| PR016_RS01960 (PR016_01960) | 400231..400782 | + | 552 | WP_278331356.1 | LemA family protein | - |
| PR016_RS01965 (PR016_01965) | 400878..402152 | + | 1275 | WP_278331357.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14773.01 Da Isoelectric Point: 5.0344
>T270204 WP_111217666.1 NZ_CP117261:398681-399088 [Rhizobium tumorigenes]
VTTAATNFLDTNILIYAISDDRRAIQAQALLDLPFVVSGQTLNEFANVARKKLSMSWQDTSTAIEAIVSISTLVVPVDEK
VTLAALKLAPLYNLSFYDAAMIAAALQAGCKQYYSEDMQHGLVVEKHLTIVNPFH
VTTAATNFLDTNILIYAISDDRRAIQAQALLDLPFVVSGQTLNEFANVARKKLSMSWQDTSTAIEAIVSISTLVVPVDEK
VTLAALKLAPLYNLSFYDAAMIAAALQAGCKQYYSEDMQHGLVVEKHLTIVNPFH
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|