Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 159856..160445 | Replicon | chromosome |
Accession | NZ_CP117261 | ||
Organism | Rhizobium tumorigenes strain 932 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PR016_RS00800 | Protein ID | WP_111216718.1 |
Coordinates | 160116..160445 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PR016_RS00795 | Protein ID | WP_278331203.1 |
Coordinates | 159856..160116 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR016_RS00790 (PR016_00790) | 157998..159794 | + | 1797 | WP_278331202.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
PR016_RS00795 (PR016_00795) | 159856..160116 | + | 261 | WP_278331203.1 | antitoxin | Antitoxin |
PR016_RS00800 (PR016_00800) | 160116..160445 | + | 330 | WP_111216718.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PR016_RS00805 (PR016_00805) | 160487..161695 | + | 1209 | WP_278331204.1 | acetyl-CoA C-acetyltransferase | - |
PR016_RS00810 (PR016_00810) | 161698..162081 | + | 384 | WP_278331205.1 | cupin domain-containing protein | - |
PR016_RS00815 (PR016_00815) | 162097..164307 | + | 2211 | WP_278331206.1 | 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein | - |
PR016_RS00820 (PR016_00820) | 164687..165151 | - | 465 | WP_278331207.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11956.69 Da Isoelectric Point: 9.1988
>T270202 WP_111216718.1 NZ_CP117261:160116-160445 [Rhizobium tumorigenes]
MERGEIWFVDLEPTRGREQANERYAMILSPKVVNQHGTQIVAPITTGGQFARTSGFAVSLSGAGTRSTGVVLCHQIRAVD
IKARRGRFVEKAPDFIVDEVLARVAALFD
MERGEIWFVDLEPTRGREQANERYAMILSPKVVNQHGTQIVAPITTGGQFARTSGFAVSLSGAGTRSTGVVLCHQIRAVD
IKARRGRFVEKAPDFIVDEVLARVAALFD
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|