Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 747486..748171 | Replicon | plasmid pRt1078 |
| Accession | NZ_CP117256 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PR017_RS21205 | Protein ID | WP_111217068.1 |
| Coordinates | 747749..748171 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PR017_RS21200 | Protein ID | WP_111217148.1 |
| Coordinates | 747486..747752 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS21180 (PR017_21180) | 744029..744202 | + | 174 | WP_206423114.1 | hypothetical protein | - |
| PR017_RS21185 (PR017_21185) | 744151..745228 | + | 1078 | Protein_685 | IS630 family transposase | - |
| PR017_RS21190 (PR017_21190) | 745254..745403 | + | 150 | WP_161959286.1 | methyltransferase domain-containing protein | - |
| PR017_RS21195 (PR017_21195) | 745567..745866 | + | 300 | WP_111217072.1 | hypothetical protein | - |
| PR017_RS21200 (PR017_21200) | 747486..747752 | + | 267 | WP_111217148.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PR017_RS21205 (PR017_21205) | 747749..748171 | + | 423 | WP_111217068.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PR017_RS21210 (PR017_21210) | 748208..748771 | + | 564 | WP_111217066.1 | hypothetical protein | - |
| PR017_RS21215 (PR017_21215) | 749219..749542 | + | 324 | WP_111217064.1 | hypothetical protein | - |
| PR017_RS21220 (PR017_21220) | 750199..750627 | - | 429 | WP_111217061.1 | MucR family transcriptional regulator | - |
| PR017_RS21225 (PR017_21225) | 751236..752006 | + | 771 | WP_111217059.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PR017_RS21230 (PR017_21230) | 752237..753046 | + | 810 | WP_111217057.1 | mechanosensitive ion channel | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..834411 | 834411 | |
| - | flank | IS/Tn | - | - | 744151..744951 | 800 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15562.99 Da Isoelectric Point: 5.6638
>T270200 WP_111217068.1 NZ_CP117256:747749-748171 [Rhizobium tumorigenes]
MRLLLDTNVLSEVTKLRPTERVLNWLHGLDEDRTFISIVSIAEIRRGVALMEIGRKRDALDAWLTHDLPQRFENRIIPVD
GHVTLAWGDLMALAKQSGRGLASMDGLIAATAVACNLTLATRNTKDFEGFGIDLVDPWAV
MRLLLDTNVLSEVTKLRPTERVLNWLHGLDEDRTFISIVSIAEIRRGVALMEIGRKRDALDAWLTHDLPQRFENRIIPVD
GHVTLAWGDLMALAKQSGRGLASMDGLIAATAVACNLTLATRNTKDFEGFGIDLVDPWAV
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|