Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 145380..146050 | Replicon | plasmid pRt1078 |
Accession | NZ_CP117256 | ||
Organism | Rhizobium tumorigenes strain 1078 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PR017_RS18460 | Protein ID | WP_111215811.1 |
Coordinates | 145380..145799 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PR017_RS18465 | Protein ID | WP_111215819.1 |
Coordinates | 145796..146050 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR017_RS18435 (PR017_18435) | 140426..140626 | + | 201 | WP_111215818.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PR017_RS18440 (PR017_18440) | 140623..141006 | + | 384 | WP_111215816.1 | type II toxin-antitoxin system VapC family toxin | - |
PR017_RS18445 (PR017_18445) | 142034..142861 | - | 828 | WP_111215821.1 | SDR family oxidoreductase | - |
PR017_RS18450 (PR017_18450) | 142885..144078 | - | 1194 | WP_111215815.1 | phytanoyl-CoA dioxygenase family protein | - |
PR017_RS18455 (PR017_18455) | 144178..145194 | + | 1017 | WP_240538814.1 | LacI family DNA-binding transcriptional regulator | - |
PR017_RS18460 (PR017_18460) | 145380..145799 | - | 420 | WP_111215811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PR017_RS18465 (PR017_18465) | 145796..146050 | - | 255 | WP_111215819.1 | plasmid stabilization protein | Antitoxin |
PR017_RS18470 (PR017_18470) | 146218..146981 | + | 764 | WP_111215810.1 | IS5 family transposase | - |
PR017_RS18475 (PR017_18475) | 147118..148344 | - | 1227 | WP_111219125.1 | IS701 family transposase | - |
PR017_RS18480 (PR017_18480) | 148643..148906 | + | 264 | WP_111215804.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PR017_RS18485 (PR017_18485) | 148944..149258 | + | 315 | WP_111215803.1 | putative addiction module antidote protein | - |
PR017_RS18490 (PR017_18490) | 149527..150315 | - | 789 | WP_240538813.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..834411 | 834411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14834.11 Da Isoelectric Point: 5.6982
>T270197 WP_111215811.1 NZ_CP117256:c145799-145380 [Rhizobium tumorigenes]
MILLDTNVVSEPWKPAPDTAVLTWLDAQAIETLFISAISIAELRFGIASMPSGKRQTILHDRLEGEVLPIFDGRVLPFNV
GTAQFYAKLMASARTSGKAIGKADGCIAATAAENHLAVATRDTSPFEAAGVRVINPWVA
MILLDTNVVSEPWKPAPDTAVLTWLDAQAIETLFISAISIAELRFGIASMPSGKRQTILHDRLEGEVLPIFDGRVLPFNV
GTAQFYAKLMASARTSGKAIGKADGCIAATAAENHLAVATRDTSPFEAAGVRVINPWVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|