Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 140426..141006 | Replicon | plasmid pRt1078 |
| Accession | NZ_CP117256 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PR017_RS18440 | Protein ID | WP_111215816.1 |
| Coordinates | 140623..141006 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PR017_RS18435 | Protein ID | WP_111215818.1 |
| Coordinates | 140426..140626 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS18410 (PR017_18410) | 136097..137122 | + | 1026 | WP_111218184.1 | IS110 family transposase | - |
| PR017_RS18415 (PR017_18415) | 137416..137786 | - | 371 | Protein_131 | transposase | - |
| PR017_RS18425 (PR017_18425) | 139071..139418 | - | 348 | Protein_133 | transposase | - |
| PR017_RS18430 (PR017_18430) | 139477..139920 | - | 444 | WP_240538815.1 | alpha/beta hydrolase fold domain-containing protein | - |
| PR017_RS18435 (PR017_18435) | 140426..140626 | + | 201 | WP_111215818.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PR017_RS18440 (PR017_18440) | 140623..141006 | + | 384 | WP_111215816.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PR017_RS18445 (PR017_18445) | 142034..142861 | - | 828 | WP_111215821.1 | SDR family oxidoreductase | - |
| PR017_RS18450 (PR017_18450) | 142885..144078 | - | 1194 | WP_111215815.1 | phytanoyl-CoA dioxygenase family protein | - |
| PR017_RS18455 (PR017_18455) | 144178..145194 | + | 1017 | WP_240538814.1 | LacI family DNA-binding transcriptional regulator | - |
| PR017_RS18460 (PR017_18460) | 145380..145799 | - | 420 | WP_111215811.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..834411 | 834411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14064.29 Da Isoelectric Point: 7.0612
>T270196 WP_111215816.1 NZ_CP117256:140623-141006 [Rhizobium tumorigenes]
VILVDTSIWIDHFRHSDADLRKVIADDRLLCHPVVIGELALGSLRDRGVVMAFFSAQREALVASHDEVMTMIDRHSIFSM
GIGYTDAHLLASTLLDRRLLLWTRDKRLAAAAQKAGASLYAPTIAPN
VILVDTSIWIDHFRHSDADLRKVIADDRLLCHPVVIGELALGSLRDRGVVMAFFSAQREALVASHDEVMTMIDRHSIFSM
GIGYTDAHLLASTLLDRRLLLWTRDKRLAAAAQKAGASLYAPTIAPN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|