Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 2561959..2562547 | Replicon | chromosome |
| Accession | NZ_CP117255 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PR017_RS12485 | Protein ID | WP_111218848.1 |
| Coordinates | 2561959..2562264 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PR017_RS12490 | Protein ID | WP_111218850.1 |
| Coordinates | 2562257..2562547 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS12465 (PR017_12465) | 2557103..2557894 | + | 792 | WP_111218840.1 | aldolase | - |
| PR017_RS12470 (PR017_12470) | 2558147..2559094 | - | 948 | WP_111218842.1 | substrate-binding domain-containing protein | - |
| PR017_RS12475 (PR017_12475) | 2559168..2560175 | - | 1008 | WP_111219027.1 | ABC transporter permease | - |
| PR017_RS12480 (PR017_12480) | 2560187..2561707 | - | 1521 | WP_111218844.1 | sugar ABC transporter ATP-binding protein | - |
| PR017_RS12485 (PR017_12485) | 2561959..2562264 | + | 306 | WP_111218848.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PR017_RS12490 (PR017_12490) | 2562257..2562547 | + | 291 | WP_111218850.1 | putative addiction module antidote protein | Antitoxin |
| PR017_RS12495 (PR017_12495) | 2562592..2563902 | - | 1311 | WP_111218852.1 | xylose isomerase | - |
| PR017_RS12500 (PR017_12500) | 2564017..2565471 | - | 1455 | WP_111218854.1 | xylulokinase | - |
| PR017_RS12505 (PR017_12505) | 2565496..2566521 | - | 1026 | WP_111218856.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11388.86 Da Isoelectric Point: 9.9057
>T270195 WP_111218848.1 NZ_CP117255:2561959-2562264 [Rhizobium tumorigenes]
MLELRQTAAFAKWRQRLTDDRARAIIASRLDRLAYGHSGDAQSVGDGVQELRIHYGPGYRIYFKTRGNTLIILLCGGDKS
TQARDISAAKRLLTEWNDDHG
MLELRQTAAFAKWRQRLTDDRARAIIASRLDRLAYGHSGDAQSVGDGVQELRIHYGPGYRIYFKTRGNTLIILLCGGDKS
TQARDISAAKRLLTEWNDDHG
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|