Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1467214..1467818 | Replicon | chromosome |
| Accession | NZ_CP117255 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PR017_RS07335 | Protein ID | WP_111221911.1 |
| Coordinates | 1467214..1467519 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PR017_RS07340 | Protein ID | WP_111221910.1 |
| Coordinates | 1467516..1467818 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS07315 (PR017_07315) | 1462650..1463012 | + | 363 | WP_111221915.1 | glycine cleavage system protein GcvH | - |
| PR017_RS07320 (PR017_07320) | 1463012..1465876 | + | 2865 | WP_111221914.1 | aminomethyl-transferring glycine dehydrogenase | - |
| PR017_RS07325 (PR017_07325) | 1465912..1466535 | - | 624 | WP_111221913.1 | LysE family transporter | - |
| PR017_RS07330 (PR017_07330) | 1466631..1467023 | - | 393 | WP_111221912.1 | Fe-S cluster assembly scaffold SufA | - |
| PR017_RS07335 (PR017_07335) | 1467214..1467519 | + | 306 | WP_111221911.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PR017_RS07340 (PR017_07340) | 1467516..1467818 | + | 303 | WP_111221910.1 | putative addiction module antidote protein | Antitoxin |
| PR017_RS07345 (PR017_07345) | 1467819..1468199 | - | 381 | WP_111221909.1 | SUF system Fe-S cluster assembly protein | - |
| PR017_RS07350 (PR017_07350) | 1468314..1469555 | - | 1242 | WP_111222002.1 | cysteine desulfurase | - |
| PR017_RS07355 (PR017_07355) | 1469568..1470842 | - | 1275 | WP_111221908.1 | Fe-S cluster assembly protein SufD | - |
| PR017_RS07360 (PR017_07360) | 1470865..1471620 | - | 756 | WP_111221907.1 | Fe-S cluster assembly ATPase SufC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11806.74 Da Isoelectric Point: 10.8373
>T270193 WP_111221911.1 NZ_CP117255:1467214-1467519 [Rhizobium tumorigenes]
VFVIQRTEIFQQWIMRLKDRRAAARIASRILRAEDGNLGDVKAVGDGVEEMRIDYGPGYRIYFLRRRSVLVVLLVGGDKS
TQRRDIIEAKRLCAEWKERNK
VFVIQRTEIFQQWIMRLKDRRAAARIASRILRAEDGNLGDVKAVGDGVEEMRIDYGPGYRIYFLRRRSVLVVLLVGGDKS
TQRRDIIEAKRLCAEWKERNK
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|