Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 973436..974023 | Replicon | chromosome |
Accession | NZ_CP117255 | ||
Organism | Rhizobium tumorigenes strain 1078 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PR017_RS04825 | Protein ID | WP_111220547.1 |
Coordinates | 973733..974023 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PR017_RS04820 | Protein ID | WP_111220546.1 |
Coordinates | 973436..973732 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR017_RS04800 (PR017_04800) | 969362..970315 | + | 954 | WP_240539013.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PR017_RS04805 (PR017_04805) | 970361..971152 | - | 792 | WP_111220544.1 | sulfite exporter TauE/SafE family protein | - |
PR017_RS04810 (PR017_04810) | 971175..972107 | - | 933 | WP_111220545.1 | N-acetyl-gamma-glutamyl-phosphate reductase | - |
PR017_RS04815 (PR017_04815) | 972190..973143 | - | 954 | WP_111220801.1 | agmatinase | - |
PR017_RS04820 (PR017_04820) | 973436..973732 | - | 297 | WP_111220546.1 | putative addiction module antidote protein | Antitoxin |
PR017_RS04825 (PR017_04825) | 973733..974023 | - | 291 | WP_111220547.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PR017_RS04830 (PR017_04830) | 974148..974618 | - | 471 | WP_111220548.1 | 30S ribosomal protein S9 | - |
PR017_RS04835 (PR017_04835) | 974621..975085 | - | 465 | WP_111220549.1 | 50S ribosomal protein L13 | - |
PR017_RS04840 (PR017_04840) | 975674..976000 | - | 327 | WP_111220550.1 | hypothetical protein | - |
PR017_RS04845 (PR017_04845) | 976110..976541 | + | 432 | WP_111220551.1 | CoA-binding protein | - |
PR017_RS04850 (PR017_04850) | 976660..977943 | + | 1284 | WP_111220552.1 | O-acetylhomoserine aminocarboxypropyltransferase | - |
PR017_RS04855 (PR017_04855) | 978070..978414 | + | 345 | WP_111220553.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10717.43 Da Isoelectric Point: 10.2980
>T270192 WP_111220547.1 NZ_CP117255:c974023-973733 [Rhizobium tumorigenes]
VIEVRQTAIFANWLDALRDAQARQRIVVRIRRLELGNPGDIKPVGEGVSEMRITHGPGYRLYFTRSGDMIVVLLCGGDKS
SQARDIAIARQLAKEI
VIEVRQTAIFANWLDALRDAQARQRIVVRIRRLELGNPGDIKPVGEGVSEMRITHGPGYRLYFTRSGDMIVVLLCGGDKS
SQARDIAIARQLAKEI
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|