Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 832629..833245 | Replicon | chromosome |
| Accession | NZ_CP117255 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PR017_RS04095 | Protein ID | WP_111220785.1 |
| Coordinates | 832943..833245 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PR017_RS04090 | Protein ID | WP_111220422.1 |
| Coordinates | 832629..832946 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS04050 (PR017_04050) | 827676..828482 | - | 807 | WP_111220414.1 | mechanosensitive ion channel | - |
| PR017_RS04055 (PR017_04055) | 828542..829066 | - | 525 | WP_111220415.1 | tyrosine phosphatase family protein | - |
| PR017_RS04060 (PR017_04060) | 829063..829683 | - | 621 | WP_111220416.1 | HD family hydrolase | - |
| PR017_RS04065 (PR017_04065) | 829680..830519 | - | 840 | WP_111220417.1 | folate-binding protein YgfZ | - |
| PR017_RS04070 (PR017_04070) | 830598..831347 | - | 750 | WP_111220418.1 | hypothetical protein | - |
| PR017_RS04075 (PR017_04075) | 831364..831621 | - | 258 | WP_142829924.1 | hypothetical protein | - |
| PR017_RS04080 (PR017_04080) | 831731..832156 | - | 426 | WP_111220420.1 | TIGR02301 family protein | - |
| PR017_RS04085 (PR017_04085) | 832216..832632 | - | 417 | WP_111220421.1 | NUDIX domain-containing protein | - |
| PR017_RS04090 (PR017_04090) | 832629..832946 | - | 318 | WP_111220422.1 | putative addiction module antidote protein | Antitoxin |
| PR017_RS04095 (PR017_04095) | 832943..833245 | - | 303 | WP_111220785.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PR017_RS04100 (PR017_04100) | 833314..833634 | + | 321 | WP_111220786.1 | YnfA family protein | - |
| PR017_RS04105 (PR017_04105) | 833677..834441 | + | 765 | WP_111220423.1 | SOS response-associated peptidase | - |
| PR017_RS04110 (PR017_04110) | 834474..835085 | + | 612 | WP_111220424.1 | LysE/ArgO family amino acid transporter | - |
| PR017_RS04115 (PR017_04115) | 835082..835222 | - | 141 | WP_164498240.1 | hypothetical protein | - |
| PR017_RS04120 (PR017_04120) | 835485..836345 | - | 861 | WP_111220425.1 | CDP-diacylglycerol--serine O-phosphatidyltransferase | - |
| PR017_RS04125 (PR017_04125) | 836367..837065 | - | 699 | WP_111220426.1 | phosphatidylserine decarboxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11205.86 Da Isoelectric Point: 10.2349
>T270191 WP_111220785.1 NZ_CP117255:c833245-832943 [Rhizobium tumorigenes]
VIEIRETEVYAGWFSRLRDERAKARINARIFRLANGNAGGHKSLGNSVLALRIDYGPGYRVYYTMLESVVVLLLCGGDKS
SQVDDITKARTLAEAARKFR
VIEIRETEVYAGWFSRLRDERAKARINARIFRLANGNAGGHKSLGNSVLALRIDYGPGYRVYYTMLESVVVLLLCGGDKS
SQVDDITKARTLAEAARKFR
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|