Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 422697..423331 | Replicon | chromosome |
| Accession | NZ_CP117255 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PR017_RS02095 | Protein ID | WP_111217666.1 |
| Coordinates | 422924..423331 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PR017_RS02090 | Protein ID | WP_111217664.1 |
| Coordinates | 422697..422927 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS02070 (PR017_02070) | 418629..419240 | + | 612 | WP_133255555.1 | hypothetical protein | - |
| PR017_RS02075 (PR017_02075) | 419544..421349 | + | 1806 | WP_161959296.1 | DUF3857 domain-containing protein | - |
| PR017_RS02080 (PR017_02080) | 421560..422423 | + | 864 | WP_111217660.1 | S49 family peptidase | - |
| PR017_RS02085 (PR017_02085) | 422442..422633 | + | 192 | WP_111217662.1 | hypothetical protein | - |
| PR017_RS02090 (PR017_02090) | 422697..422927 | + | 231 | WP_111217664.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PR017_RS02095 (PR017_02095) | 422924..423331 | + | 408 | WP_111217666.1 | PIN domain-containing protein | Toxin |
| PR017_RS02100 (PR017_02100) | 423420..424379 | + | 960 | WP_111217917.1 | glycine--tRNA ligase subunit alpha | - |
| PR017_RS02105 (PR017_02105) | 424474..425025 | + | 552 | WP_111217668.1 | LemA family protein | - |
| PR017_RS02110 (PR017_02110) | 425122..426396 | + | 1275 | WP_111217670.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14773.01 Da Isoelectric Point: 5.0344
>T270189 WP_111217666.1 NZ_CP117255:422924-423331 [Rhizobium tumorigenes]
VTTAATNFLDTNILIYAISDDRRAIQAQALLDLPFVVSGQTLNEFANVARKKLSMSWQDTSTAIEAIVSISTLVVPVDEK
VTLAALKLAPLYNLSFYDAAMIAAALQAGCKQYYSEDMQHGLVVEKHLTIVNPFH
VTTAATNFLDTNILIYAISDDRRAIQAQALLDLPFVVSGQTLNEFANVARKKLSMSWQDTSTAIEAIVSISTLVVPVDEK
VTLAALKLAPLYNLSFYDAAMIAAALQAGCKQYYSEDMQHGLVVEKHLTIVNPFH
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|