Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 182559..183148 | Replicon | chromosome |
| Accession | NZ_CP117255 | ||
| Organism | Rhizobium tumorigenes strain 1078 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PR017_RS00925 | Protein ID | WP_111216718.1 |
| Coordinates | 182819..183148 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | PR017_RS00920 | Protein ID | WP_111216716.1 |
| Coordinates | 182559..182819 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PR017_RS00915 (PR017_00915) | 180700..182496 | + | 1797 | WP_111216715.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
| PR017_RS00920 (PR017_00920) | 182559..182819 | + | 261 | WP_111216716.1 | antitoxin | Antitoxin |
| PR017_RS00925 (PR017_00925) | 182819..183148 | + | 330 | WP_111216718.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PR017_RS00930 (PR017_00930) | 183193..184401 | + | 1209 | WP_111216720.1 | acetyl-CoA C-acetyltransferase | - |
| PR017_RS00935 (PR017_00935) | 184404..184787 | + | 384 | WP_111216722.1 | cupin domain-containing protein | - |
| PR017_RS00940 (PR017_00940) | 184804..187014 | + | 2211 | WP_111216724.1 | 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein | - |
| PR017_RS00945 (PR017_00945) | 187392..187733 | - | 342 | WP_111216726.1 | oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11956.69 Da Isoelectric Point: 9.1988
>T270188 WP_111216718.1 NZ_CP117255:182819-183148 [Rhizobium tumorigenes]
MERGEIWFVDLEPTRGREQANERYAMILSPKVVNQHGTQIVAPITTGGQFARTSGFAVSLSGAGTRSTGVVLCHQIRAVD
IKARRGRFVEKAPDFIVDEVLARVAALFD
MERGEIWFVDLEPTRGREQANERYAMILSPKVVNQHGTQIVAPITTGGQFARTSGFAVSLSGAGTRSTGVVLCHQIRAVD
IKARRGRFVEKAPDFIVDEVLARVAALFD
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|