Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 84562..85187 | Replicon | plasmid pATCC14028_1 |
| Accession | NZ_CP117245 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PQQ30_RS24205 | Protein ID | WP_000911322.1 |
| Coordinates | 84562..84960 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PQQ30_RS24210 | Protein ID | WP_000450265.1 |
| Coordinates | 84960..85187 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ30_RS24190 (PQQ30_24190) | 80753..81247 | + | 495 | WP_010999946.1 | entry exclusion protein | - |
| PQQ30_RS24195 (PQQ30_24195) | 81283..82014 | + | 732 | WP_000782438.1 | conjugal transfer complement resistance protein TraT | - |
| PQQ30_RS24200 (PQQ30_24200) | 82391..84553 | + | 2163 | WP_000009318.1 | type IV conjugative transfer system coupling protein TraD | - |
| PQQ30_RS24205 (PQQ30_24205) | 84562..84960 | - | 399 | WP_000911322.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQQ30_RS24210 (PQQ30_24210) | 84960..85187 | - | 228 | WP_000450265.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB | 1..93832 | 93832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14887.13 Da Isoelectric Point: 8.5264
>T270187 WP_000911322.1 NZ_CP117245:c84960-84562 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|