Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 18189..18714 Replicon plasmid pATCC14028_1
Accession NZ_CP117245
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag PQQ30_RS23790 Protein ID WP_001159863.1
Coordinates 18409..18714 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag PQQ30_RS23785 Protein ID WP_000813641.1
Coordinates 18189..18407 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ30_RS23755 (PQQ30_23755) 13476..13857 + 382 Protein_15 YgiW/YdeI family stress tolerance OB fold protein -
PQQ30_RS23760 (PQQ30_23760) 14026..14470 + 445 Protein_16 tyrosine-type recombinase/integrase -
PQQ30_RS23765 (PQQ30_23765) 14729..15718 - 990 WP_001527061.1 RepB family plasmid replication initiator protein -
PQQ30_RS23770 (PQQ30_23770) 16212..16508 - 297 WP_001687482.1 hypothetical protein -
PQQ30_RS23775 (PQQ30_23775) 16520..16948 + 429 Protein_19 hypothetical protein -
PQQ30_RS23780 (PQQ30_23780) 16992..17513 - 522 WP_010999942.1 hypothetical protein -
PQQ30_RS23785 (PQQ30_23785) 18189..18407 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PQQ30_RS23790 (PQQ30_23790) 18409..18714 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
PQQ30_RS23795 (PQQ30_23795) 18716..19006 + 291 WP_001266176.1 hypothetical protein -
PQQ30_RS23800 (PQQ30_23800) 19003..19524 + 522 WP_000198608.1 hypothetical protein -
PQQ30_RS23805 (PQQ30_23805) 19559..20341 + 783 WP_000082169.1 site-specific integrase -
PQQ30_RS23810 (PQQ30_23810) 20350..20901 + 552 WP_000545754.1 EAL domain-containing protein -
PQQ30_RS23815 (PQQ30_23815) 21088..21576 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQQ30_RS23820 (PQQ30_23820) 21570..22055 + 486 WP_000905606.1 membrane protein -
PQQ30_RS23825 (PQQ30_23825) 22332..22619 - 288 WP_071530243.1 hypothetical protein -
PQQ30_RS23830 (PQQ30_23830) 22775..23335 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB 1..93832 93832
- flank IS/Tn - - 23402..23752 350


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T270186 WP_001159863.1 NZ_CP117245:18409-18714 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT270186 WP_000813641.1 NZ_CP117245:18189-18407 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References