Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2180106..2180635 | Replicon | chromosome |
Accession | NZ_CP117242 | ||
Organism | Staphylococcus aureus strain ATCC 14458 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PQQ25_RS11410 | Protein ID | WP_000621175.1 |
Coordinates | 2180106..2180468 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | PQQ25_RS11415 | Protein ID | WP_000948331.1 |
Coordinates | 2180465..2180635 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ25_RS11390 (2177083) | 2177083..2177853 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
PQQ25_RS11395 (2177828) | 2177828..2178307 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
PQQ25_RS11400 (2178309) | 2178309..2178635 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
PQQ25_RS11405 (2178755) | 2178755..2179756 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
PQQ25_RS11410 (2180106) | 2180106..2180468 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PQQ25_RS11415 (2180465) | 2180465..2180635 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PQQ25_RS11420 (2180720) | 2180720..2181868 | - | 1149 | WP_001281145.1 | alanine racemase | - |
PQQ25_RS11425 (2181934) | 2181934..2182293 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
PQQ25_RS11430 (2182297) | 2182297..2182788 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
PQQ25_RS11435 (2182775) | 2182775..2184358 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
PQQ25_RS11440 (2184351) | 2184351..2184830 | - | 480 | WP_001287088.1 | hypothetical protein | - |
PQQ25_RS11445 (2185039) | 2185039..2185599 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T270161 WP_000621175.1 NZ_CP117242:c2180468-2180106 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|