Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 878789..879321 | Replicon | chromosome |
| Accession | NZ_CP117242 | ||
| Organism | Staphylococcus aureus strain ATCC 14458 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | Q93CD4 |
| Locus tag | PQQ25_RS04695 | Protein ID | WP_001103942.1 |
| Coordinates | 879001..879321 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | PQQ25_RS04690 | Protein ID | WP_001058486.1 |
| Coordinates | 878789..878998 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ25_RS04645 (873808) | 873808..875028 | - | 1221 | WP_000266157.1 | site-specific integrase | - |
| PQQ25_RS04650 (875117) | 875117..875845 | - | 729 | WP_000733775.1 | staphylococcal enterotoxin type K | - |
| PQQ25_RS04655 (875869) | 875869..876597 | - | 729 | WP_001033316.1 | staphylococcal enterotoxin type Q | - |
| PQQ25_RS04660 (876667) | 876667..877098 | - | 432 | WP_001228759.1 | hypothetical protein | - |
| PQQ25_RS04665 (877115) | 877115..877573 | - | 459 | WP_000281657.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PQQ25_RS04670 (877585) | 877585..877917 | - | 333 | WP_001260004.1 | helix-turn-helix transcriptional regulator | - |
| PQQ25_RS04675 (878110) | 878110..878373 | + | 264 | WP_000243851.1 | helix-turn-helix transcriptional regulator | - |
| PQQ25_RS04680 (878366) | 878366..878638 | + | 273 | WP_000091731.1 | helix-turn-helix domain-containing protein | - |
| PQQ25_RS04685 (878650) | 878650..878796 | + | 147 | WP_000784875.1 | hypothetical protein | - |
| PQQ25_RS04690 (878789) | 878789..878998 | + | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
| PQQ25_RS04695 (879001) | 879001..879321 | + | 321 | WP_001103942.1 | DUF1474 family protein | Toxin |
| PQQ25_RS04700 (879385) | 879385..880254 | + | 870 | WP_044557201.1 | primase alpha helix C-terminal domain-containing protein | - |
| PQQ25_RS04705 (880271) | 880271..881728 | + | 1458 | WP_000390455.1 | virulence-associated E family protein | - |
| PQQ25_RS04710 (882029) | 882029..882391 | + | 363 | WP_001039168.1 | hypothetical protein | - |
| PQQ25_RS04715 (882393) | 882393..882677 | + | 285 | WP_000998181.1 | hypothetical protein | - |
| PQQ25_RS04720 (882674) | 882674..883315 | + | 642 | WP_001019764.1 | hypothetical protein | - |
| PQQ25_RS04725 (883832) | 883832..884173 | + | 342 | WP_001190615.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / selq / seb | 855859..889123 | 33264 | |
| - | inside | Prophage | - | vWbp / selk / selq / seb | 847503..889123 | 41620 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12694.22 Da Isoelectric Point: 4.7419
>T270156 WP_001103942.1 NZ_CP117242:879001-879321 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|