270156

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 878789..879321 Replicon chromosome
Accession NZ_CP117242
Organism Staphylococcus aureus strain ATCC 14458

Toxin (Protein)


Gene name TscT Uniprot ID Q93CD4
Locus tag PQQ25_RS04695 Protein ID WP_001103942.1
Coordinates 879001..879321 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag PQQ25_RS04690 Protein ID WP_001058486.1
Coordinates 878789..878998 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ25_RS04645 (873808) 873808..875028 - 1221 WP_000266157.1 site-specific integrase -
PQQ25_RS04650 (875117) 875117..875845 - 729 WP_000733775.1 staphylococcal enterotoxin type K -
PQQ25_RS04655 (875869) 875869..876597 - 729 WP_001033316.1 staphylococcal enterotoxin type Q -
PQQ25_RS04660 (876667) 876667..877098 - 432 WP_001228759.1 hypothetical protein -
PQQ25_RS04665 (877115) 877115..877573 - 459 WP_000281657.1 ImmA/IrrE family metallo-endopeptidase -
PQQ25_RS04670 (877585) 877585..877917 - 333 WP_001260004.1 helix-turn-helix transcriptional regulator -
PQQ25_RS04675 (878110) 878110..878373 + 264 WP_000243851.1 helix-turn-helix transcriptional regulator -
PQQ25_RS04680 (878366) 878366..878638 + 273 WP_000091731.1 helix-turn-helix domain-containing protein -
PQQ25_RS04685 (878650) 878650..878796 + 147 WP_000784875.1 hypothetical protein -
PQQ25_RS04690 (878789) 878789..878998 + 210 WP_001058486.1 hypothetical protein Antitoxin
PQQ25_RS04695 (879001) 879001..879321 + 321 WP_001103942.1 DUF1474 family protein Toxin
PQQ25_RS04700 (879385) 879385..880254 + 870 WP_044557201.1 primase alpha helix C-terminal domain-containing protein -
PQQ25_RS04705 (880271) 880271..881728 + 1458 WP_000390455.1 virulence-associated E family protein -
PQQ25_RS04710 (882029) 882029..882391 + 363 WP_001039168.1 hypothetical protein -
PQQ25_RS04715 (882393) 882393..882677 + 285 WP_000998181.1 hypothetical protein -
PQQ25_RS04720 (882674) 882674..883315 + 642 WP_001019764.1 hypothetical protein -
PQQ25_RS04725 (883832) 883832..884173 + 342 WP_001190615.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq / seb 855859..889123 33264
- inside Prophage - vWbp / selk / selq / seb 847503..889123 41620


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12694.22 Da        Isoelectric Point: 4.7419

>T270156 WP_001103942.1 NZ_CP117242:879001-879321 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT270156 WP_001058486.1 NZ_CP117242:878789-878998 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93CD4

Antitoxin

Source ID Structure

References