Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 861175..861652 Replicon chromosome
Accession NZ_CP117242
Organism Staphylococcus aureus strain ATCC 14458

Toxin (Protein)


Gene name TsaT Uniprot ID A0A0H3K6W0
Locus tag PQQ25_RS04550 Protein ID WP_000052077.1
Coordinates 861175..861363 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PQQ25_RS04555 Protein ID WP_001059690.1
Coordinates 861392..861652 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ25_RS04520 (857216) 857216..857686 + 471 WP_000824472.1 hypothetical protein -
PQQ25_RS04525 (858027) 858027..858713 + 687 WP_001548082.1 thermonuclease family protein -
PQQ25_RS04530 (859070) 859070..859270 + 201 WP_001059082.1 cold-shock protein -
PQQ25_RS04535 (859766) 859766..859984 - 219 WP_000005886.1 hypothetical protein -
PQQ25_RS04540 (860046) 860046..860330 - 285 WP_001004395.1 hypothetical protein -
PQQ25_RS04545 (860418) 860418..860987 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
PQQ25_RS04550 (861175) 861175..861363 - 189 WP_000052077.1 hypothetical protein Toxin
PQQ25_RS04555 (861392) 861392..861652 - 261 WP_001059690.1 hypothetical protein Antitoxin
PQQ25_RS04560 (861993) 861993..862196 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PQQ25_RS04565 (862193) 862193..862429 - 237 WP_000368687.1 hypothetical protein -
PQQ25_RS04570 (862654) 862654..863235 + 582 WP_001140693.1 histidine phosphatase family protein -
PQQ25_RS04575 (863308) 863308..863925 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
PQQ25_RS04580 (864080) 864080..864574 - 495 WP_000569886.1 GNAT family N-acetyltransferase -
PQQ25_RS04585 (864973) 864973..865395 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
PQQ25_RS04590 (865543) 865543..866259 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk / selq / seb 855859..889123 33264
- inside Prophage - vWbp / selk / selq / seb 847503..889123 41620


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7186.87 Da        Isoelectric Point: 9.9971

>T270155 WP_000052077.1 NZ_CP117242:c861363-861175 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTIILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT270155 WP_001059690.1 NZ_CP117242:c861652-861392 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3K6W0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References