Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2041009..2041538 | Replicon | chromosome |
Accession | NZ_CP117238 | ||
Organism | Staphylococcus aureus strain ATCC 23235 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PQQ27_RS10180 | Protein ID | WP_000621175.1 |
Coordinates | 2041009..2041371 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | PQQ27_RS10185 | Protein ID | WP_000948331.1 |
Coordinates | 2041368..2041538 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ27_RS10160 (PQQ27_10160) | 2037987..2038757 | - | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
PQQ27_RS10165 (PQQ27_10165) | 2038732..2039211 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
PQQ27_RS10170 (PQQ27_10170) | 2039213..2039539 | - | 327 | WP_001052796.1 | anti-sigma factor antagonist | - |
PQQ27_RS10175 (PQQ27_10175) | 2039658..2040659 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
PQQ27_RS10180 (PQQ27_10180) | 2041009..2041371 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PQQ27_RS10185 (PQQ27_10185) | 2041368..2041538 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PQQ27_RS10190 (PQQ27_10190) | 2041623..2042771 | - | 1149 | WP_001281153.1 | alanine racemase | - |
PQQ27_RS10195 (PQQ27_10195) | 2042837..2043196 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
PQQ27_RS10200 (PQQ27_10200) | 2043200..2043691 | - | 492 | WP_001205912.1 | PH domain-containing protein | - |
PQQ27_RS10205 (PQQ27_10205) | 2043678..2045261 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
PQQ27_RS10210 (PQQ27_10210) | 2045254..2045733 | - | 480 | WP_001287087.1 | hypothetical protein | - |
PQQ27_RS10215 (PQQ27_10215) | 2045941..2046501 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T270149 WP_000621175.1 NZ_CP117238:c2041371-2041009 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|