Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 808502..808979 Replicon chromosome
Accession NZ_CP117238
Organism Staphylococcus aureus strain ATCC 23235

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PQQ27_RS03985 Protein ID WP_000052076.1
Coordinates 808502..808690 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PQQ27_RS03990 Protein ID WP_001059690.1
Coordinates 808719..808979 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ27_RS03955 (PQQ27_03955) 804496..805017 + 522 WP_000824482.1 hypothetical protein -
PQQ27_RS03960 (PQQ27_03960) 805358..806044 + 687 WP_000141557.1 thermonuclease family protein -
PQQ27_RS03965 (PQQ27_03965) 806401..806601 + 201 WP_001059082.1 cold-shock protein -
PQQ27_RS03970 (PQQ27_03970) 807093..807311 - 219 WP_000005886.1 hypothetical protein -
PQQ27_RS03975 (PQQ27_03975) 807373..807657 - 285 WP_001004399.1 hypothetical protein -
PQQ27_RS03980 (PQQ27_03980) 807745..808314 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
PQQ27_RS03985 (PQQ27_03985) 808502..808690 - 189 WP_000052076.1 hypothetical protein Toxin
PQQ27_RS03990 (PQQ27_03990) 808719..808979 - 261 WP_001059690.1 hypothetical protein Antitoxin
PQQ27_RS03995 (PQQ27_03995) 809320..809523 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PQQ27_RS04000 (PQQ27_04000) 809520..809756 - 237 WP_000349581.1 hypothetical protein -
PQQ27_RS04005 (PQQ27_04005) 809981..810562 + 582 WP_001140693.1 histidine phosphatase family protein -
PQQ27_RS04010 (PQQ27_04010) 810635..811252 - 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
PQQ27_RS04015 (PQQ27_04015) 811407..811901 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
PQQ27_RS04020 (PQQ27_04020) 812300..812722 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
PQQ27_RS04025 (PQQ27_04025) 812870..813586 + 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T270146 WP_000052076.1 NZ_CP117238:c808690-808502 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT270146 WP_001059690.1 NZ_CP117238:c808979-808719 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References