Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4419563..4420398 | Replicon | chromosome |
| Accession | NZ_CP117235 | ||
| Organism | Escherichia coli strain ATCC 25922 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | PQQ28_RS21775 | Protein ID | WP_000854759.1 |
| Coordinates | 4419563..4419940 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | PQQ28_RS21780 | Protein ID | WP_001295723.1 |
| Coordinates | 4420030..4420398 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ28_RS21750 (4415674) | 4415674..4417296 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| PQQ28_RS21755 (4418087) | 4418087..4418263 | - | 177 | Protein_4191 | helix-turn-helix domain-containing protein | - |
| PQQ28_RS21760 (4418630) | 4418630..4418779 | - | 150 | Protein_4192 | hypothetical protein | - |
| PQQ28_RS21765 (4418885) | 4418885..4419061 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| PQQ28_RS21770 (4419078) | 4419078..4419566 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| PQQ28_RS21775 (4419563) | 4419563..4419940 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| PQQ28_RS21780 (4420030) | 4420030..4420398 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PQQ28_RS21785 (4420561) | 4420561..4420782 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| PQQ28_RS21790 (4420845) | 4420845..4421321 | - | 477 | WP_001186775.1 | RadC family protein | - |
| PQQ28_RS21795 (4421337) | 4421337..4421810 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| PQQ28_RS21800 (4422152) | 4422152..4422970 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| PQQ28_RS21805 (4423088) | 4423088..4423283 | - | 196 | Protein_4201 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4408022..4434934 | 26912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T270143 WP_000854759.1 NZ_CP117235:c4419940-4419563 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT270143 WP_001295723.1 NZ_CP117235:c4420398-4420030 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |