Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4232213..4232763 Replicon chromosome
Accession NZ_CP117235
Organism Escherichia coli strain ATCC 25922

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag PQQ28_RS20845 Protein ID WP_001160966.1
Coordinates 4232213..4232527 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag PQQ28_RS20850 Protein ID WP_000125566.1
Coordinates 4232530..4232763 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ28_RS20820 (4227888) 4227888..4229174 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
PQQ28_RS20825 (4229174) 4229174..4230163 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
PQQ28_RS20830 (4230160) 4230160..4230981 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PQQ28_RS20835 (4230984) 4230984..4231361 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
PQQ28_RS20840 (4231368) 4231368..4232216 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
PQQ28_RS20845 (4232213) 4232213..4232527 - 315 WP_001160966.1 CcdB family protein Toxin
PQQ28_RS20850 (4232530) 4232530..4232763 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQQ28_RS20855 (4232849) 4232849..4233328 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
PQQ28_RS20860 (4233520) 4233520..4235382 - 1863 WP_000377123.1 glutathione-regulated potassium-efflux system protein KefC -
PQQ28_RS20865 (4235375) 4235375..4235905 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
PQQ28_RS20870 (4236013) 4236013..4237344 - 1332 WP_001183207.1 MFS transporter -
PQQ28_RS20875 (4237403) 4237403..4237690 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T270140 WP_001160966.1 NZ_CP117235:c4232527-4232213 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT270140 WP_000125566.1 NZ_CP117235:c4232763-4232530 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References