Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3738229..3738847 | Replicon | chromosome |
Accession | NZ_CP117235 | ||
Organism | Escherichia coli strain ATCC 25922 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PQQ28_RS18540 | Protein ID | WP_001291435.1 |
Coordinates | 3738629..3738847 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PQQ28_RS18535 | Protein ID | WP_000344800.1 |
Coordinates | 3738229..3738603 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ28_RS18525 (3733319) | 3733319..3734512 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ28_RS18530 (3734535) | 3734535..3737684 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
PQQ28_RS18535 (3738229) | 3738229..3738603 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ28_RS18540 (3738629) | 3738629..3738847 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PQQ28_RS18545 (3739020) | 3739020..3739571 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
PQQ28_RS18550 (3739687) | 3739687..3740157 | + | 471 | WP_001304825.1 | YlaC family protein | - |
PQQ28_RS18555 (3740321) | 3740321..3741871 | + | 1551 | WP_001528761.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PQQ28_RS18560 (3741913) | 3741913..3742266 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PQQ28_RS18570 (3742645) | 3742645..3742956 | + | 312 | WP_000409908.1 | MGMT family protein | - |
PQQ28_RS18575 (3742987) | 3742987..3743559 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T270138 WP_001291435.1 NZ_CP117235:3738629-3738847 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT270138 WP_000344800.1 NZ_CP117235:3738229-3738603 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |