Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2097360..2097889 Replicon chromosome
Accession NZ_CP117230
Organism Staphylococcus aureus strain ATCC 25923

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag PQQ26_RS10385 Protein ID WP_000621176.1
Coordinates 2097360..2097722 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag PQQ26_RS10390 Protein ID WP_000948331.1
Coordinates 2097719..2097889 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ26_RS10365 (PQQ26_10365) 2094338..2095108 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
PQQ26_RS10370 (PQQ26_10370) 2095083..2095562 - 480 WP_001190825.1 anti-sigma B factor RsbW -
PQQ26_RS10375 (PQQ26_10375) 2095564..2095890 - 327 WP_001052491.1 anti-sigma factor antagonist -
PQQ26_RS10380 (PQQ26_10380) 2096009..2097010 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
PQQ26_RS10385 (PQQ26_10385) 2097360..2097722 - 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PQQ26_RS10390 (PQQ26_10390) 2097719..2097889 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
PQQ26_RS10395 (PQQ26_10395) 2097974..2099122 - 1149 WP_001281140.1 alanine racemase -
PQQ26_RS10400 (PQQ26_10400) 2099188..2099547 - 360 WP_000581197.1 holo-ACP synthase -
PQQ26_RS10405 (PQQ26_10405) 2099551..2100042 - 492 WP_001286801.1 PH domain-containing protein -
PQQ26_RS10410 (PQQ26_10410) 2100035..2101612 - 1578 WP_001294646.1 PH domain-containing protein -
PQQ26_RS10415 (PQQ26_10415) 2101605..2102084 - 480 WP_001287082.1 hypothetical protein -
PQQ26_RS10420 (PQQ26_10420) 2102293..2102853 - 561 WP_001092414.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T270117 WP_000621176.1 NZ_CP117230:c2097722-2097360 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT270117 WP_000948331.1 NZ_CP117230:c2097889-2097719 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References