Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 2044653..2045182 Replicon chromosome
Accession NZ_CP117230
Organism Staphylococcus aureus strain ATCC 25923

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6DV13
Locus tag PQQ26_RS10110 Protein ID WP_001103929.1
Coordinates 2044653..2044970 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag PQQ26_RS10115 Protein ID WP_001058486.1
Coordinates 2044973..2045182 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ26_RS10080 (PQQ26_10080) 2039963..2040304 - 342 WP_001161492.1 hypothetical protein -
PQQ26_RS10085 (PQQ26_10085) 2040651..2041292 - 642 WP_038413070.1 pathogenicity island protein -
PQQ26_RS10090 (PQQ26_10090) 2041289..2041573 - 285 WP_000998182.1 hypothetical protein -
PQQ26_RS10095 (PQQ26_10095) 2041575..2041937 - 363 WP_001039171.1 hypothetical protein -
PQQ26_RS10100 (PQQ26_10100) 2042234..2043703 - 1470 WP_001834090.1 virulence-associated E family protein -
PQQ26_RS10105 (PQQ26_10105) 2043720..2044589 - 870 WP_001002839.1 primase alpha helix C-terminal domain-containing protein -
PQQ26_RS10110 (PQQ26_10110) 2044653..2044970 - 318 WP_001103929.1 DUF1474 family protein Toxin
PQQ26_RS10115 (PQQ26_10115) 2044973..2045182 - 210 WP_001058486.1 hypothetical protein Antitoxin
PQQ26_RS10120 (PQQ26_10120) 2045175..2045321 - 147 WP_000833313.1 hypothetical protein -
PQQ26_RS10125 (PQQ26_10125) 2045318..2045635 - 318 WP_000481972.1 helix-turn-helix domain-containing protein -
PQQ26_RS10130 (PQQ26_10130) 2045649..2046290 - 642 WP_000595329.1 phage repressor protein -
PQQ26_RS10135 (PQQ26_10135) 2046294..2046506 - 213 WP_000448765.1 helix-turn-helix transcriptional regulator -
PQQ26_RS10140 (PQQ26_10140) 2046660..2047322 + 663 WP_001070979.1 helix-turn-helix transcriptional regulator -
PQQ26_RS10145 (PQQ26_10145) 2047335..2048507 + 1173 WP_000024832.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - groEL 2026176..2050552 24376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12666.19 Da        Isoelectric Point: 4.5462

>T270116 WP_001103929.1 NZ_CP117230:c2044970-2044653 [Staphylococcus aureus]
MNWEIKDLICDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HELEKASSENFDEESDDAQKLKITE

Download         Length: 318 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT270116 WP_001058486.1 NZ_CP117230:c2045182-2044973 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6DV13

Antitoxin

Source ID Structure

References