Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 2044653..2045182 | Replicon | chromosome |
| Accession | NZ_CP117230 | ||
| Organism | Staphylococcus aureus strain ATCC 25923 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A0C6DV13 |
| Locus tag | PQQ26_RS10110 | Protein ID | WP_001103929.1 |
| Coordinates | 2044653..2044970 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | PQQ26_RS10115 | Protein ID | WP_001058486.1 |
| Coordinates | 2044973..2045182 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ26_RS10080 (PQQ26_10080) | 2039963..2040304 | - | 342 | WP_001161492.1 | hypothetical protein | - |
| PQQ26_RS10085 (PQQ26_10085) | 2040651..2041292 | - | 642 | WP_038413070.1 | pathogenicity island protein | - |
| PQQ26_RS10090 (PQQ26_10090) | 2041289..2041573 | - | 285 | WP_000998182.1 | hypothetical protein | - |
| PQQ26_RS10095 (PQQ26_10095) | 2041575..2041937 | - | 363 | WP_001039171.1 | hypothetical protein | - |
| PQQ26_RS10100 (PQQ26_10100) | 2042234..2043703 | - | 1470 | WP_001834090.1 | virulence-associated E family protein | - |
| PQQ26_RS10105 (PQQ26_10105) | 2043720..2044589 | - | 870 | WP_001002839.1 | primase alpha helix C-terminal domain-containing protein | - |
| PQQ26_RS10110 (PQQ26_10110) | 2044653..2044970 | - | 318 | WP_001103929.1 | DUF1474 family protein | Toxin |
| PQQ26_RS10115 (PQQ26_10115) | 2044973..2045182 | - | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
| PQQ26_RS10120 (PQQ26_10120) | 2045175..2045321 | - | 147 | WP_000833313.1 | hypothetical protein | - |
| PQQ26_RS10125 (PQQ26_10125) | 2045318..2045635 | - | 318 | WP_000481972.1 | helix-turn-helix domain-containing protein | - |
| PQQ26_RS10130 (PQQ26_10130) | 2045649..2046290 | - | 642 | WP_000595329.1 | phage repressor protein | - |
| PQQ26_RS10135 (PQQ26_10135) | 2046294..2046506 | - | 213 | WP_000448765.1 | helix-turn-helix transcriptional regulator | - |
| PQQ26_RS10140 (PQQ26_10140) | 2046660..2047322 | + | 663 | WP_001070979.1 | helix-turn-helix transcriptional regulator | - |
| PQQ26_RS10145 (PQQ26_10145) | 2047335..2048507 | + | 1173 | WP_000024832.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL | 2026176..2050552 | 24376 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12666.19 Da Isoelectric Point: 4.5462
>T270116 WP_001103929.1 NZ_CP117230:c2044970-2044653 [Staphylococcus aureus]
MNWEIKDLICDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HELEKASSENFDEESDDAQKLKITE
MNWEIKDLICDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HELEKASSENFDEESDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|