Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 820503..820980 Replicon chromosome
Accession NZ_CP117230
Organism Staphylococcus aureus strain ATCC 25923

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PQQ26_RS03890 Protein ID WP_000052076.1
Coordinates 820503..820691 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PQQ26_RS03895 Protein ID WP_001059690.1
Coordinates 820720..820980 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ26_RS03860 (PQQ26_03860) 816456..817013 + 558 WP_000824491.1 hypothetical protein -
PQQ26_RS03865 (PQQ26_03865) 817354..818040 + 687 WP_001574556.1 thermonuclease family protein -
PQQ26_RS03870 (PQQ26_03870) 818397..818597 + 201 WP_001059082.1 cold-shock protein -
PQQ26_RS03875 (PQQ26_03875) 819094..819312 - 219 WP_000005879.1 hypothetical protein -
PQQ26_RS03880 (PQQ26_03880) 819374..819658 - 285 WP_001004401.1 hypothetical protein -
PQQ26_RS03885 (PQQ26_03885) 819746..820315 - 570 WP_001106663.1 lipoprotein N-acylation protein LnsA -
PQQ26_RS03890 (PQQ26_03890) 820503..820691 - 189 WP_000052076.1 hypothetical protein Toxin
PQQ26_RS03895 (PQQ26_03895) 820720..820980 - 261 WP_001059690.1 hypothetical protein Antitoxin
PQQ26_RS03900 (PQQ26_03900) 821322..821525 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PQQ26_RS03905 (PQQ26_03905) 821522..821758 - 237 WP_000368687.1 hypothetical protein -
PQQ26_RS03910 (PQQ26_03910) 821983..822564 + 582 WP_001140696.1 histidine phosphatase family protein -
PQQ26_RS03915 (PQQ26_03915) 822637..823254 - 618 WP_000255548.1 LysE/ArgO family amino acid transporter -
PQQ26_RS03920 (PQQ26_03920) 823410..823904 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
PQQ26_RS03925 (PQQ26_03925) 824303..824725 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
PQQ26_RS03930 (PQQ26_03930) 824873..825589 + 717 WP_000150022.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T270113 WP_000052076.1 NZ_CP117230:c820691-820503 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT270113 WP_001059690.1 NZ_CP117230:c820980-820720 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References