Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 363585..364120 Replicon chromosome
Accession NZ_CP117230
Organism Staphylococcus aureus strain ATCC 25923

Toxin (Protein)


Gene name TscT Uniprot ID A0A4P7P340
Locus tag PQQ26_RS01620 Protein ID WP_001103945.1
Coordinates 363797..364120 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag PQQ26_RS01615 Protein ID WP_001058486.1
Coordinates 363585..363794 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ26_RS01580 (PQQ26_01580) 359132..359374 + 243 WP_000897044.1 30S ribosomal protein S18 -
PQQ26_RS01585 (PQQ26_01585) 359606..360439 - 834 WP_000370312.1 type II toxin-antitoxin system PemK/MazF family toxin -
PQQ26_RS01590 (PQQ26_01590) 360440..361654 - 1215 WP_000270132.1 site-specific integrase -
PQQ26_RS01595 (PQQ26_01595) 362110..362805 - 696 WP_000668212.1 helix-turn-helix domain-containing protein -
PQQ26_RS01600 (PQQ26_01600) 362949..363161 + 213 WP_000794656.1 helix-turn-helix transcriptional regulator -
PQQ26_RS01605 (PQQ26_01605) 363162..363434 + 273 WP_000091734.1 helix-turn-helix domain-containing protein -
PQQ26_RS01610 (PQQ26_01610) 363446..363592 + 147 WP_031824147.1 hypothetical protein -
PQQ26_RS01615 (PQQ26_01615) 363585..363794 + 210 WP_001058486.1 hypothetical protein Antitoxin
PQQ26_RS01620 (PQQ26_01620) 363797..364120 + 324 WP_001103945.1 DUF1474 family protein Toxin
PQQ26_RS01625 (PQQ26_01625) 364185..365054 + 870 WP_001002723.1 primase alpha helix C-terminal domain-containing protein -
PQQ26_RS01630 (PQQ26_01630) 365068..366777 + 1710 WP_000447449.1 DUF927 domain-containing protein -
PQQ26_RS01635 (PQQ26_01635) 367089..367469 + 381 WP_000356936.1 hypothetical protein -
PQQ26_RS01640 (PQQ26_01640) 367466..368107 + 642 WP_001019780.1 hypothetical protein -
PQQ26_RS01645 (PQQ26_01645) 368624..368965 + 342 WP_001190612.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 358577..377989 19412


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-90)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12665.26 Da        Isoelectric Point: 4.7124

>T270112 WP_001103945.1 NZ_CP117230:363797-364120 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKNSIKVAE

Download         Length: 324 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT270112 WP_001058486.1 NZ_CP117230:363585-363794 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7P340

Antitoxin

Source ID Structure

References