Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 363585..364120 | Replicon | chromosome |
| Accession | NZ_CP117230 | ||
| Organism | Staphylococcus aureus strain ATCC 25923 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | A0A4P7P340 |
| Locus tag | PQQ26_RS01620 | Protein ID | WP_001103945.1 |
| Coordinates | 363797..364120 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | PQQ26_RS01615 | Protein ID | WP_001058486.1 |
| Coordinates | 363585..363794 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ26_RS01580 (PQQ26_01580) | 359132..359374 | + | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| PQQ26_RS01585 (PQQ26_01585) | 359606..360439 | - | 834 | WP_000370312.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PQQ26_RS01590 (PQQ26_01590) | 360440..361654 | - | 1215 | WP_000270132.1 | site-specific integrase | - |
| PQQ26_RS01595 (PQQ26_01595) | 362110..362805 | - | 696 | WP_000668212.1 | helix-turn-helix domain-containing protein | - |
| PQQ26_RS01600 (PQQ26_01600) | 362949..363161 | + | 213 | WP_000794656.1 | helix-turn-helix transcriptional regulator | - |
| PQQ26_RS01605 (PQQ26_01605) | 363162..363434 | + | 273 | WP_000091734.1 | helix-turn-helix domain-containing protein | - |
| PQQ26_RS01610 (PQQ26_01610) | 363446..363592 | + | 147 | WP_031824147.1 | hypothetical protein | - |
| PQQ26_RS01615 (PQQ26_01615) | 363585..363794 | + | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
| PQQ26_RS01620 (PQQ26_01620) | 363797..364120 | + | 324 | WP_001103945.1 | DUF1474 family protein | Toxin |
| PQQ26_RS01625 (PQQ26_01625) | 364185..365054 | + | 870 | WP_001002723.1 | primase alpha helix C-terminal domain-containing protein | - |
| PQQ26_RS01630 (PQQ26_01630) | 365068..366777 | + | 1710 | WP_000447449.1 | DUF927 domain-containing protein | - |
| PQQ26_RS01635 (PQQ26_01635) | 367089..367469 | + | 381 | WP_000356936.1 | hypothetical protein | - |
| PQQ26_RS01640 (PQQ26_01640) | 367466..368107 | + | 642 | WP_001019780.1 | hypothetical protein | - |
| PQQ26_RS01645 (PQQ26_01645) | 368624..368965 | + | 342 | WP_001190612.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 358577..377989 | 19412 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12665.26 Da Isoelectric Point: 4.7124
>T270112 WP_001103945.1 NZ_CP117230:363797-364120 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKNSIKVAE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFDELIQKF
HEIEKASSDVSLATESDDAKNSIKVAE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|