Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 864059..864688 | Replicon | chromosome |
Accession | NZ_CP117229 | ||
Organism | Listeria innocua strain ATCC 33090 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | Q92DC7 |
Locus tag | PQQ29_RS04765 | Protein ID | WP_010990666.1 |
Coordinates | 864341..864688 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | H1GC21 |
Locus tag | PQQ29_RS04760 | Protein ID | WP_003761302.1 |
Coordinates | 864059..864337 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ29_RS04740 (PQQ29_04740) | 859356..860840 | + | 1485 | WP_187984061.1 | PH domain-containing protein | - |
PQQ29_RS04745 (PQQ29_04745) | 860991..862370 | + | 1380 | WP_070753404.1 | protoporphyrinogen oxidase | - |
PQQ29_RS04750 (PQQ29_04750) | 862372..862728 | + | 357 | WP_003761296.1 | holo-ACP synthase | - |
PQQ29_RS04755 (PQQ29_04755) | 862747..863853 | + | 1107 | WP_187984062.1 | alanine racemase | - |
PQQ29_RS04760 (PQQ29_04760) | 864059..864337 | + | 279 | WP_003761302.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PQQ29_RS04765 (PQQ29_04765) | 864341..864688 | + | 348 | WP_010990666.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PQQ29_RS04770 (PQQ29_04770) | 864940..865776 | + | 837 | WP_003771126.1 | STAS domain-containing protein | - |
PQQ29_RS04775 (PQQ29_04775) | 865782..866138 | + | 357 | WP_187984063.1 | STAS domain-containing protein | - |
PQQ29_RS04780 (PQQ29_04780) | 866141..866551 | + | 411 | WP_010990667.1 | anti-sigma regulatory factor | - |
PQQ29_RS04785 (PQQ29_04785) | 866568..867572 | + | 1005 | WP_045553450.1 | PP2C family protein-serine/threonine phosphatase | - |
PQQ29_RS04790 (PQQ29_04790) | 867722..868066 | + | 345 | WP_187997213.1 | anti sigma b factor antagonist RsbV | - |
PQQ29_RS04795 (PQQ29_04795) | 868050..868523 | + | 474 | WP_003761314.1 | anti-sigma B factor RsbW | - |
PQQ29_RS04800 (PQQ29_04800) | 868501..869280 | + | 780 | WP_010990669.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12801.85 Da Isoelectric Point: 6.4735
>T270111 WP_010990666.1 NZ_CP117229:864341-864688 [Listeria innocua]
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMAKVNQALEVSLGVVEF
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMAKVNQALEVSLGVVEF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1E7E4N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H1GC21 |