Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 79714..80207 Replicon plasmid pATCC33090_1
Accession NZ_CP117228
Organism Listeria innocua strain ATCC 33090

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag PQQ29_RS00435 Protein ID WP_068995950.1
Coordinates 79932..80207 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PQQ29_RS00430 Protein ID WP_068995951.1
Coordinates 79714..79935 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ29_RS00390 (PQQ29_00390) 74756..74968 + 213 WP_068995955.1 hypothetical protein -
PQQ29_RS00395 (PQQ29_00395) 74961..75497 + 537 WP_068995954.1 HTH domain-containing protein -
PQQ29_RS00400 (PQQ29_00400) 75830..76420 + 591 WP_055308612.1 helix-turn-helix transcriptional regulator -
PQQ29_RS00405 (PQQ29_00405) 76564..76908 + 345 WP_002375364.1 PadR family transcriptional regulator -
PQQ29_RS00410 (PQQ29_00410) 76898..77719 + 822 WP_061775510.1 hypothetical protein -
PQQ29_RS00415 (PQQ29_00415) 77825..78411 + 587 Protein_82 recombinase family protein -
PQQ29_RS00420 (PQQ29_00420) 78392..78718 + 327 WP_068995953.1 hypothetical protein -
PQQ29_RS00425 (PQQ29_00425) 78799..79479 + 681 WP_176714219.1 IS6 family transposase -
PQQ29_RS00430 (PQQ29_00430) 79714..79935 + 222 WP_068995951.1 DUF6290 family protein Antitoxin
PQQ29_RS00435 (PQQ29_00435) 79932..80207 + 276 WP_068995950.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ29_RS00440 (PQQ29_00440) 80229..80408 + 180 WP_068995949.1 hypothetical protein -
PQQ29_RS00445 (PQQ29_00445) 80442..82346 + 1905 WP_070232215.1 hypothetical protein -
PQQ29_RS00450 (PQQ29_00450) 82362..82634 + 273 WP_068995947.1 DUF5592 family protein -
PQQ29_RS00455 (PQQ29_00455) 82636..83175 + 540 WP_077316130.1 hypothetical protein -
PQQ29_RS00460 (PQQ29_00460) 83172..85130 + 1959 WP_187983845.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..104612 104612
- flank IS/Tn - - 78799..79479 680


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-89)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10882.57 Da        Isoelectric Point: 10.4614

>T270110 WP_068995950.1 NZ_CP117228:79932-80207 [Listeria innocua]
MSKHFHVRFEKDAQKVLKKMDRFQAKLILSWIEKHIEGSDNPRQHGKSLVGNRVGQWRYRVGDYRLIAEIQDNEVIVLIL
NIGHRRDIYDK

Download         Length: 276 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8509.66 Da        Isoelectric Point: 4.4929

>AT270110 WP_068995951.1 NZ_CP117228:79714-79935 [Listeria innocua]
MTTITFRVSEQEKAFIQEMAKFNGISISELSRKQIIEGLEDQIDLQSYERAIKAHQVKDESISFDEMKKELDL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References