Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4874453..4874969 | Replicon | chromosome |
| Accession | NZ_CP117227 | ||
| Organism | Klebsiella pneumoniae strain ATCC BAA2146 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | PQQ24_RS26225 | Protein ID | WP_002886902.1 |
| Coordinates | 4874453..4874737 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | PQQ24_RS26230 | Protein ID | WP_002886901.1 |
| Coordinates | 4874727..4874969 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ24_RS26200 (PQQ24_26200) | 4869937..4870200 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| PQQ24_RS26205 (PQQ24_26205) | 4870330..4870503 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| PQQ24_RS26210 (PQQ24_26210) | 4870506..4871249 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| PQQ24_RS26215 (PQQ24_26215) | 4871606..4873744 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQQ24_RS26220 (PQQ24_26220) | 4873985..4874449 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQQ24_RS26225 (PQQ24_26225) | 4874453..4874737 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ24_RS26230 (PQQ24_26230) | 4874727..4874969 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQQ24_RS26235 (PQQ24_26235) | 4875047..4876957 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| PQQ24_RS26240 (PQQ24_26240) | 4876980..4878134 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| PQQ24_RS26245 (PQQ24_26245) | 4878200..4878940 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T270107 WP_002886902.1 NZ_CP117227:c4874737-4874453 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |