Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4148930..4149549 Replicon chromosome
Accession NZ_CP117227
Organism Klebsiella pneumoniae strain ATCC BAA2146

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PQQ24_RS22740 Protein ID WP_002892050.1
Coordinates 4149331..4149549 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PQQ24_RS22735 Protein ID WP_002892066.1
Coordinates 4148930..4149304 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ24_RS22725 (PQQ24_22725) 4144082..4145275 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PQQ24_RS22730 (PQQ24_22730) 4145298..4148444 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
PQQ24_RS22735 (PQQ24_22735) 4148930..4149304 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PQQ24_RS22740 (PQQ24_22740) 4149331..4149549 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PQQ24_RS22745 (PQQ24_22745) 4149708..4150274 + 567 WP_002892030.1 maltose O-acetyltransferase -
PQQ24_RS22750 (PQQ24_22750) 4150246..4150386 - 141 WP_004147370.1 hypothetical protein -
PQQ24_RS22755 (PQQ24_22755) 4150407..4150877 + 471 WP_002892026.1 YlaC family protein -
PQQ24_RS22760 (PQQ24_22760) 4150852..4152303 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PQQ24_RS22765 (PQQ24_22765) 4152404..4153102 + 699 WP_002892021.1 GNAT family protein -
PQQ24_RS22770 (PQQ24_22770) 4153099..4153239 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PQQ24_RS22775 (PQQ24_22775) 4153239..4153502 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T270105 WP_002892050.1 NZ_CP117227:4149331-4149549 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT270105 WP_002892066.1 NZ_CP117227:4148930-4149304 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References