Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 79708..80351 Replicon plasmid pATCCBAA2146_2
Accession NZ_CP117226
Organism Klebsiella pneumoniae strain ATCC BAA2146

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag PQQ24_RS01875 Protein ID WP_001044770.1
Coordinates 79708..80124 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag PQQ24_RS01880 Protein ID WP_001261282.1
Coordinates 80121..80351 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ24_RS01845 (PQQ24_01845) 75560..76264 + 705 WP_020324562.1 IS6-like element IS26 family transposase -
PQQ24_RS01850 (PQQ24_01850) 76570..77127 + 558 WP_001217881.1 recombinase family protein -
PQQ24_RS01855 (PQQ24_01855) 77361..77915 + 555 WP_063840280.1 AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase -
PQQ24_RS01860 (PQQ24_01860) 77985..78176 + 192 Protein_91 nucleotidyltransferase domain-containing protein -
PQQ24_RS01870 (PQQ24_01870) 78945..79634 - 690 Protein_93 AAA family ATPase -
PQQ24_RS01875 (PQQ24_01875) 79708..80124 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
PQQ24_RS01880 (PQQ24_01880) 80121..80351 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQQ24_RS01885 (PQQ24_01885) 80308..80535 + 228 Protein_96 hypothetical protein -
PQQ24_RS01890 (PQQ24_01890) 80862..81314 - 453 WP_004201034.1 hypothetical protein -
PQQ24_RS01895 (PQQ24_01895) 82122..82472 + 351 WP_000493378.1 hypothetical protein -
PQQ24_RS01900 (PQQ24_01900) 82523..83266 + 744 WP_000129823.1 hypothetical protein -
PQQ24_RS01905 (PQQ24_01905) 83263..84039 + 777 WP_000015958.1 site-specific integrase -
PQQ24_RS01910 (PQQ24_01910) 84097..84354 - 258 WP_000764642.1 hypothetical protein -
PQQ24_RS01915 (PQQ24_01915) 84483..84587 - 105 WP_032409716.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaSHV-187 / qnrB9 / dfrA14 / aac(6')-Ib - 1..85160 85160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T270095 WP_001044770.1 NZ_CP117226:c80124-79708 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT270095 WP_001261282.1 NZ_CP117226:c80351-80121 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References